Recombinant Halobacterium salinarum Sensory rhodopsin-1 (sop1)

Shipped with Ice Packs
In Stock

Description

Functional Properties and Photocycle

HsSRI undergoes a light-driven photocycle, transmitting signals via conformational changes that interact with its transducer, HtrI. Key functional attributes include:

Photocycle Mechanism

  • Light Activation: Absorbs light at ~560 nm (all-trans-retinal), generating intermediates (e.g., N-like state) .

  • Signal Relay: Transmits signals through hydrogen bonding between Tyr-210 and Asn-53, critical for HtrI interaction .

  • Stability: Recombinant HsSRI retains stability in high-salt buffers (4 M NaCl) and detergents (0.03% DDM) .

Spectroscopic Data

ParameterValueSource
λₘₐₓ (Absorption)560–590 nm
Extinction Coefficient63,000 M⁻¹ cm⁻¹ (560 nm)
Absorbance Ratio280 nm / 590 nm = 1.7

Comparative Analysis with NpSRII

FeatureHsSRINpSRII
StabilityModerateHigh (detergent-resistant)
Salt ToleranceRequires high salt (4 M NaCl)Stable in dilute solutions

Applications in Research

Recombinant HsSRI is widely used in:

ApplicationDetailsSource
Protein CrystallizationServes as a membrane protein control in crystallization assays
Biochemical StudiesInvestigates photocycle kinetics, retinal binding, and transducer interactions
SDS-PAGE/Western BlotPurity confirmation (>98%) and epitope detection
Signal TransductionModels phototaxis signaling and receptor-transducer coupling

Expression and Purification

  • Yield: 3–4 mg/L in E. coli .

  • Purification: Ni-NTA affinity chromatography under high-salt conditions (4 M NaCl) .

Functional Validation

  • Retinal Binding: UV-Vis spectra confirm covalent retinal attachment (A₂₈₀/A₅₉₀ = 1.7) .

  • Photocycle Kinetics: Global fit analysis reveals N-like intermediate formation, critical for signal relay .

Comparative Genomics

  • Homologs in Salinibacter ruber: SrSRI (40% identity to HsSRI) retains functional residues (Asn-165, His-166, Asp-201, Arg-215) .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To prioritize a specific tag type, please inform us during your order placement.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-239
Protein Length
full length protein
Target Names
sop1
Target Protein Sequence
MDAVATAYLGGAVALIVGVAFVWLLYRSLDGSPHQSALAPLAIIPVFAGLSYVGMAYDIG TVIVNGNQIVGLRYIDWLVTTPILVGYVGYAAGASRRSIIGVMVADALMIAVGAGAVVTD GTLKWALFGVSSIFHLSLFAYLYVIFPRVVPDVPEQIGLFNLLKNHIGLLWLAYPLVWLF GPAGIGEATAAGVALTYVFLDVLAKVPYVYFFYARRRVFMHSESPPAPEQATVEATAAD
Uniprot No.

Q&A

What is Sensory rhodopsin-1 (SopI) in Halobacterium salinarum?

Sensory rhodopsin-1 (also known as SR-I or SopI) is a 7-transmembrane photoreceptor protein that functions as a phototaxis receptor in Halobacterium salinarum. The protein undergoes a photocycle when activated by light, triggering signaling cascades that control the swimming behavior of the organism. SopI specifically mediates positive phototaxis, directing the organism toward favorable light conditions . Structurally, it contains a retinal chromophore covalently bound to a lysine residue, enabling light absorption and subsequent photochemical reactions .

What are the key structural and biochemical properties of SopI?

SopI from Halobacterium salinarum is a 234-amino acid protein (when expressed with a C-terminal His-tag and lacking 15 amino acids at the C-terminus) with a molecular weight of approximately 25,423 Da. Its structure contains seven transmembrane domains characteristic of the rhodopsin family. The protein has an absorption maximum at 590 nm and an extinction coefficient of 54,000 M⁻¹ cm⁻¹ at this wavelength . The amino acid sequence includes important functional regions that facilitate interaction with its cognate transducer protein (HtrI) and retinal binding. When properly folded and with bound retinal, SopI displays a characteristic absorption spectrum with a peak at 590 nm and a protein absorbance peak at 280 nm, with a typical absorbance ratio (280 nm/590 nm) of 1.7 .

How does SopI compare to other rhodopsins in halophilic archaea?

In halophilic archaea, several types of rhodopsins exist with distinct functions. While SopI mediates positive phototaxis (attraction to light), Sensory rhodopsin II (SRII) mediates negative phototaxis (avoidance of harmful light) . Bacteriorhodopsin functions as a light-driven proton pump activated by 550 nm light for energy harvesting, while halorhodopsin serves as a light-driven chloride pump activated by 580 nm light to maintain cellular osmotic pressure .

Some species like Haloarcula marismortui possess three sensory rhodopsins (SRI, SRII, and SRM), where SRM (a blue-green light-sensing rhodopsin with absorption maximum at 504 nm) attenuates both positive and negative phototaxis responses . This complex interplay between different rhodopsins allows precise light sensing and energy utilization in extreme salt environments.

What expression systems are optimal for recombinant SopI production?

Recombinant SopI can be expressed in both Halobacterium species and E. coli expression systems, each with distinct advantages. For homologous expression, the coding region can be placed downstream of the bacterioopsin gene promoter and translation initiation region on a selectable vector. This construct typically encodes SopI with an extended N-terminus that includes a leader sequence and the N-terminus of bacterioopsin .

For heterologous expression in E. coli, His-tagged constructs have been successfully employed as demonstrated by commercial production protocols . The expression in E. coli offers advantages in terms of growth rate and established purification protocols, though special attention must be paid to proper folding and retinal binding. For functional validation, the recombinant protein should demonstrate characteristic spectral properties and, ideally, the ability to restore phototaxis responses in deletion strains .

What are effective purification strategies for recombinant SopI?

Purification of recombinant SopI requires specialized approaches to maintain protein stability and functionality. Metal affinity chromatography using Ni-NTA agarose is effective for His-tagged constructs . The purification buffer typically contains high salt concentration (4 M NaCl) to maintain protein stability, along with appropriate pH buffering (50 mM MES, pH 6.0) and detergent (0.03% dodecyl maltoside, DDM) to solubilize the membrane protein .

The purification process should yield protein with >98% purity as determined by SDS-PAGE. Functional integrity can be assessed through spectroscopic characterization, verifying the absorbance ratio between protein (280 nm) and retinal-bound peaks (590 nm), which should be approximately 1.7 for properly folded and retinal-bound SopI . Following purification, SopI should be stored at -80°C to avoid freeze-thaw cycles and protected from light due to its photosensitivity .

How can the SopI gene be optimized for cassette mutagenesis?

The SopI gene can be optimized for cassette mutagenesis by incorporating unique restriction sites throughout the coding region. As demonstrated in previous research, a synthetic gene encoding SopI was designed with 30 unique restriction sites distributed with uniform spacing throughout the 720-bp coding region . This approach enables the systematic replacement of gene segments for structure-function studies.

The strategic placement of these restriction sites should avoid disrupting critical functional regions while facilitating easy exchange of cassettes. Importantly, the modifications should be synonymous substitutions that preserve the amino acid sequence. Validation of the synthetic gene should confirm that the expressed protein maintains functional identity with wild-type SopI, including characteristic absorption difference spectrum, photochemical reaction cycle, and ability to restore phototaxis responses in deletion strains .

What methods are effective for creating SopI deletion strains for expression studies?

Creating SopI deletion strains involves targeted gene deletion through homologous recombination. This process requires designing DNA constructs with homology regions flanking the SopI gene (sopI) to facilitate precise deletion from the chromosome . The deletion strain provides a clean background for expressing modified or synthetic versions of the gene.

After transformation with the deletion construct, screening for successful recombinants can be performed through PCR verification and functional assays showing loss of phototaxis response. The resulting deletion strain can then be transformed with expression vectors containing synthetic or modified sopI genes. Functional complementation can be assessed by measuring the restoration of phototaxis responses and by characterizing the spectral properties of membrane preparations from the transformants .

What spectroscopic methods are most informative for studying SopI photocycle kinetics?

The SopI photocycle can be effectively studied using time-resolved absorption spectroscopy techniques. Flash-induced absorption difference spectroscopy is particularly valuable, enabling the detection of transient intermediates formed during the photocycle . This approach involves applying a short light pulse to trigger the photocycle and then monitoring absorbance changes at specific wavelengths over time.

The characteristic absorption difference spectrum of SopI shows distinctive peaks and troughs corresponding to the depletion of the ground state and formation of photointermediates. Time-resolved measurements can be analyzed using global fitting algorithms to extract the lifetimes of different photointermediates. For quantitative analysis, the extinction coefficient at 590 nm (54,000 M⁻¹ cm⁻¹) can be used to calculate concentrations and quantum yields . Temperature-dependent measurements provide additional insights into activation energies for different photocycle transitions.

How can protein-protein interactions between SopI and its transducer be studied?

The interaction between SopI and its cognate transducer HtrI can be studied using several complementary approaches. Co-expression of SopI with HtrI followed by co-purification can provide initial evidence of complex formation. Specific antibodies directed against the C-terminal region of SopI can be used to detect the protein in membrane preparations and assess its association with HtrI .

More detailed characterization can employ methods such as site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy to map interaction interfaces. Crosslinking studies using photoactivatable or chemical crosslinkers can identify specific contact points. Functional studies examining how mutations in either protein affect signal transduction provide valuable insights into the mechanism of interaction. For instance, research has identified critical hydrogen-bonding changes between specific residues (such as Tyr-210 and Asn-53) that are essential for signal relay from SopI to HtrI .

How can SopI be used as a model system for studying membrane protein folding and stability?

SopI provides an excellent model system for studying membrane protein folding due to its characteristic spectral properties that serve as built-in reporters of proper folding. The protein's adaptation to extreme salt environments offers unique insights into membrane protein stability under harsh conditions. Researchers can employ systematic mutations combined with spectroscopic analysis to identify residues critical for stability and folding.

Thermal and chemical denaturation studies monitored by absorption spectroscopy can quantify stability parameters. The effects of different detergents, lipids, and buffer conditions on folding efficiency and stability can be systematically evaluated. For heterologous expression systems, manipulating chaperone co-expression, temperature, and induction conditions can optimize proper folding. Comparative studies between SopI and other rhodopsins with different stability profiles can reveal general principles of membrane protein folding in extremophiles.

What experimental approaches can assess the effect of SopI mutations on phototaxis signaling?

To evaluate how SopI mutations affect phototaxis signaling, researchers can employ a complementation system where mutant versions of SopI are expressed in a deletion strain lacking the endogenous protein. Phototaxis responses can be quantified using motion analysis of cell populations upon light stimulation or through classical phototaxis plate assays that measure colony migration in response to light gradients .

For molecular-level analysis, mutants can be characterized by their photochemical reaction cycles using flash photolysis and compared to wild-type SopI. Critical mutations may alter the lifetimes of signaling intermediates or change the spectral properties of the protein. The interaction between mutant SopI and its transducer HtrI can be assessed through co-purification or signaling assays. Systems biology approaches combining mutations with transcriptomics or proteomics can reveal downstream effects on the signaling network.

How does SopI from H. salinarum compare to sensory rhodopsins in other archaea?

Sensory rhodopsins across different archaeal species show evolutionary adaptations to diverse environmental niches. H. salinarum SopI, with its absorption maximum at 590 nm, is specialized for detecting orange-red light. In contrast, the blue-green sensing SRM from Haloarcula marismortui (absorption maximum at 504 nm) serves to attenuate both positive and negative phototaxis responses .

The comparison of primary sequences, three-dimensional structures, and photochemical properties between these proteins reveals conserved functional motifs and species-specific adaptations. For example, while H. salinarum contains two sensory rhodopsins (SRI and SRII), H. marismortui possesses three (SRI, SRII, and SRM) . This diversity suggests evolutionary adaptation to different light environments and signaling needs. Phylogenetic analysis of sensory rhodopsins across halophilic archaea provides insights into the evolution of light-sensing mechanisms in extreme environments.

How can fusion proteins with SopI be utilized for functional studies?

Fusion proteins combining SopI with its transducer or other proteins offer powerful tools for functional studies. The SRM-HtrM fusion protein approach demonstrated in research with Haloarcula marismortui provides a template for similar studies with SopI . Such fusion constructs ensure proper stoichiometry and positioning between the receptor and transducer proteins.

For heterologous expression and purification, His-tags and other affinity tags can be incorporated without compromising function . Fusion to fluorescent proteins enables real-time visualization of localization and dynamics in living cells. Functional assessment of fusion proteins should include spectroscopic characterization and, where applicable, phototaxis assays to confirm that signaling capabilities are maintained. When transforming fusion constructs into different host organisms (like introducing H. marismortui proteins into H. salinarum), researchers can study cross-species compatibility of signaling components and regulatory effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.