Recombinant Halobacterium salinarum Sensory rhodopsin-2 (sop2)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

SR-2 is produced in E. coli with yields of 3–4 mg/L culture . Purification involves:

  • Affinity Chromatography: Ni-NTA agarose leveraging the C-terminal His-tag .

  • Buffer Composition: 4 M NaCl, 50 mM MES (pH 6.0), 0.03% dodecyl maltoside (DDM) .

  • Purity: >98% as confirmed by SDS-PAGE .

Biochemical Properties

ParameterValue
Extinction Coefficient (497 nm)48,000 M⁻¹cm⁻¹
Extinction Coefficient (590 nm)54,000 M⁻¹cm⁻¹
Absorbance Ratio (280/497 nm)1.7
Vibronic Bands420 nm, 460 nm (UV-VIS spectrum)

Functional Characteristics

SR-2 undergoes a light-triggered photocycle, enabling signal transduction:

  • Photoreception: Retinal isomerization disrupts the Asp-73–Schiff base salt bridge, activating the receptor .

  • Transducer Interaction: Binds HtrII transducer via surface residue Y199, initiating a kinase cascade regulating flagellar motion .

  • Constitutive Signaling: D73N mutation mimics photoactivation, increasing swimming reversal frequency in H. salinarum .

Laser flash spectroscopy reveals prolonged photocycle kinetics in detergent or lipid-reconstituted SR-2 .

Research Applications

SR-2 is utilized in:

  • Crystallization Assays: Ideal control protein due to stable retinal binding .

  • Phototransduction Studies: Mechanistic analysis of archaeal phototaxis .

  • Biophysical Experiments: Spectroscopy, membrane protein stability assays .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that specific requirements may arise. Should you have any particular format preference, please clearly indicate it during order placement. We will then make every effort to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein with deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for extended storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparation.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles to preserve protein integrity.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its development for your order.
Synonyms
sop2; sopII; VNG_1764G; Sensory rhodopsin-2; Sensory rhodopsin II; SR-II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-237
Protein Length
full length protein
Species
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Target Names
sop2
Target Protein Sequence
MALTTWFWVGAVGMLAGTVLPIRDCIRHPSHRRYDLVLAGITGLAAIAYTTMGLGITATT VGDRTVYLARYIDWLVTTPLIVLYLAMLARPGHRTSAWLLAADVFVIAAGIAAALTTGVQ RWLFFAVGAAGYAALLYGLLGTLPRALGDDPRVRSLFVTLRNITVVLWTLYPVVWLLSPA GIGILQTEMYTIVVVYLDFISKVAFVAFAVLGADAVSRLVAADAAAPATAEPTPDGD
Uniprot No.

Target Background

Function
Sensory rhodopsin-2 (Sop2) acts as a photophobic photoreceptor, responsible for negative phototaxis in Halobacterium salinarum. Upon exposure to blue light, it activates the sensory rhodopsin II transducer (HTR-II).
Gene References Into Functions
  1. A comprehensive analysis of the photochemical reaction cycle and photoinduced proton transfer of sensory rhodopsin II (Phoborhodopsin) from Halobacterium salinarum. PMID: 20371336
  2. Research findings demonstrate that disruptions to the salt bridge between the protonated Schiff base of the receptor's retinylidene chromophore and its counterion Asp73, achieved through residue substitutions D73A, N or Q, lead to constitutive activation of rhodopsin II (HsSRII). PMID: 17986191
  3. Water plays a pivotal role in the SRII --> HtrII transducer signal transfer mechanism within the hydrophobic core of the membrane. PMID: 19187030
Database Links
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression conditions for recombinant Halobacterium salinarum SRII in E. coli?

For high-yield heterologous expression of functional Sensory Rhodopsin-II (SRII) from Halobacterium salinarum in E. coli, a multivariate experimental design approach is recommended. The optimal conditions include:

  • Expression host: E. coli (BL21 or similar strains)

  • Typical yield: 3-4 mg of purified SRII per liter of cell culture

  • Induction parameters: 4-hour induction periods provide the highest productivity balance

  • Expression temperature: Lower temperatures (16-25°C) favor soluble protein formation

  • Media composition: Enriched media with osmolytes can improve protein folding

Statistical experimental design methodology allows for systematic optimization of multiple variables simultaneously, including media components, induction conditions, and growth parameters. This approach is significantly more effective than traditional one-variable-at-a-time optimization strategies for membrane proteins like SRII .

How can I confirm the functional integrity of purified recombinant SRII?

Proper functional characterization of purified SRII should include multiple analytical approaches:

  • UV/Vis absorption spectroscopy: Correctly folded SRII displays characteristic absorption bands with maxima at 497 nm, with additional vibronic bands at 460 nm and 420 nm. The absorbance ratio 280 nm/497 nm should approximate 1.7 .

  • Resonance Raman spectroscopy: This technique provides evidence for the strongly hydrogen-bonded Schiff base, which is critical for SRII function. The spectral signature differs from that of the homologous pSRII from Natronobacterium pharaonis, showing a profile more similar to mammalian rhodopsin .

  • Photocycle kinetics analysis: Laser flash spectroscopy can confirm that the protein exhibits its typical photochemical properties with the expected prolonged photocycle kinetics, both in detergent and after reconstitution into polar lipids .

  • Extinction coefficient verification: Functional SRII should display extinction coefficients of approximately 48,000 M⁻¹cm⁻¹ at 497 nm and 54,000 M⁻¹cm⁻¹ at 590 nm .

What is the structural basis for SRII's dual role in phototransduction and chemotransduction?

Sensory Rhodopsin-II functions as both a photoreceptor and is linked to chemotransduction through its cognate transducer protein HtrII. This dual functionality is structurally enabled by:

  • SRII-HtrII complex: SRII forms a functional complex with its transducer protein HtrII, which has been demonstrated to respond to both light stimuli and chemical attractants/repellents .

  • HtrII's unique periplasmic domain: Unlike other rhodopsin transducers, HtrII contains an unusually large periplasmic domain in its N-terminal portion, approximately 100 amino acids larger than typical eubacterial chemotransducers. This extensive extracellular region is believed to contain the chemosensing domain .

  • Signal transduction mechanism: Upon activation by either blue light (for SRII) or chemical stimuli (for the HtrII periplasmic domain), the complex modulates methylesterase activity, as evidenced by distinct methanol release patterns observed in flow assays. This eventually affects flagellar rotation and cell movement .

Experimental evidence from HtrII deletion and overexpression strains confirms the dual sensory role, with HtrII overexpression strains showing enhanced response to both serine (chemical stimulus) and blue light (photostimulus) .

What are the critical structural elements of recombinant SRII needed for functional studies?

For functional studies with recombinant SRII, several structural elements must be preserved:

Structural ElementFunctionVerification Method
Seven transmembrane helicesCore protein structureCircular dichroism, structural prediction
Retinal binding pocket (K205)Chromophore attachment siteUV-Vis spectroscopy, mutation studies
Schiff base linkageCovalent binding of all-trans retinalResonance Raman spectroscopy
HtrII interaction surfaceSignal transductionCo-purification, binding assays
Proton translocation pathwayPhotocycle functionFlash photolysis, pH-dependent assays

The full-length protein (243 amino acids; 26,103 Da) with appropriate post-translational modifications is typically required for complete functionality. While C-terminal His-tags (HHHHHH) are commonly used for purification and do not significantly affect function, they should be considered when interpreting fine structural studies .

How can recombinant SRII be effectively reconstituted into membrane systems for functional studies?

For functional reconstitution of SRII into membrane systems:

  • Detergent selection: Initial purification typically employs mild detergents like dodecyl maltoside (DDM) at 0.03% concentration to maintain protein stability .

  • Reconstitution protocol:

    • Prepare lipid vesicles (preferably polar lipids from archaea or E. coli)

    • Solubilize vesicles with detergent

    • Add purified SRII (typically in 4M NaCl, 50mM MES pH 6.0 buffer)

    • Remove detergent gradually via dialysis or adsorption onto Bio-Beads

    • Verify incorporation by flotation assays and freeze-fracture electron microscopy

  • Functionality assessment: After reconstitution, confirm SRII retains its photochemical properties using laser flash spectroscopy, which should demonstrate the characteristic prolonged photocycle kinetics similar to the native protein .

  • Co-reconstitution with HtrII: For signal transduction studies, co-reconstitution of SRII with its cognate transducer HtrII is essential. This requires careful optimization of protein:lipid ratios and may benefit from expression of both proteins as a complex .

What experimental approaches can be used to study SRII-mediated signaling pathways?

To investigate SRII-mediated signaling pathways:

  • In vivo flow assays: These can detect methanol release patterns (indicating methylesterase activity) after stimulus application. Comparison between wildtype, deletion, and overexpression strains provides insights into signaling mechanisms .

  • Agarose-in-plug bridge methods: This approach allows quantification of chemotactic responses, demonstrating (for example) that HtrII overexpression strains show enhanced response to serine compared to deletion strains .

  • Site-directed mutagenesis: Targeted mutations of key residues can identify crucial amino acids involved in signal transduction. Studies have shown that substitutions like D73E, D73N, D103N, and V106M significantly affect signaling properties .

  • Spectroscopic techniques: Time-resolved spectroscopy following photoactivation can track the conformational changes that occur during signaling, providing mechanistic insights into how structural alterations propagate from SRII to HtrII.

  • Heterologous expression systems: Functional expression of SRII with HtrII in E. coli or other hosts allows controlled mutation studies and biochemical analysis of the signaling complex .

What are common challenges in obtaining soluble recombinant SRII and how can they be addressed?

Common challenges and solutions for soluble SRII expression include:

  • Inclusion body formation: As a membrane protein, SRII tends to form inclusion bodies when overexpressed.

    • Solution: Use statistical experimental design to optimize expression conditions. Variables to optimize include induction timing, temperature, inducer concentration, and media composition .

    • Implementation: A fractional factorial design examining 8 variables with 24 experimental conditions can identify optimal parameters for soluble expression .

  • Improper chromophore incorporation: Lack of retinal binding results in non-functional protein.

    • Solution: Supplement expression media with all-trans retinal (typically 5-10 μM) during induction phase.

    • Verification: Monitor the characteristic absorption spectra (497 nm) during purification .

  • Protein misfolding due to osmotic stress:

    • Solution: Include osmolytes (glycine betaine, glycerol) and specific ions (4M NaCl) in growth media and purification buffers to mimic the halophilic environment of H. salinarum .

  • Low expression yields:

    • Solution: Codon optimization for the expression host, use of specialized expression strains (e.g., C41/C43 for membrane proteins), and careful optimization of induction parameters can increase yields from typical levels (3-4 mg/L) to higher amounts (250 mg/L) .

How can researchers validate the dual photoreceptor and chemoreceptor functions of the SRII-HtrII complex?

To validate the dual functionality of the SRII-HtrII complex:

  • Complementation studies: Transform phototaxis-deficient strains (e.g., Pho81 and Δ35) with plasmids containing the htrII-sopII locus. Functional complementation should restore repellent responses to blue light .

  • Methylation assays: Measure methanol release (indicating methylesterase activity) after:

    • Light stimulation (blue light, activating SRII)

    • Chemical stimulation (serine addition)

    Strains overexpressing HtrII should show distinct methanol peaks following both types of stimuli, while deletion strains would lack this response .

  • Behavioral assays: Monitor swimming behavior and reversal frequency in response to:

    • Photostimulation (blue light)

    • Chemical gradients (serine, glucose, histidine, leucine)

    Both stimuli should alter the frequency of swimming reversals in wildtype or complemented strains .

  • Protein-protein interaction studies: Verify SRII-HtrII physical interaction using techniques like cross-linking, co-immunoprecipitation, or FRET to confirm the structural basis for dual signaling.

How can multivariate experimental design improve the heterologous expression of SRII?

Multivariate experimental design offers significant advantages for optimizing SRII expression:

  • Systematic exploration of parameter space: Unlike traditional one-variable-at-a-time approaches, factorial designs can efficiently evaluate multiple variables simultaneously, capturing interaction effects between parameters .

  • Statistical rigor: These designs maintain orthogonality, allowing independent parameter estimation with minimal experiments, while enabling characterization of experimental error .

  • Implementation for SRII optimization:

    • Define critical variables affecting expression (e.g., temperature, inducer concentration, media components, induction time)

    • Establish a fractional factorial design (e.g., 2^8-4 with center point replicates)

    • Analyze responses for key metrics (cell growth, biological activity, productivity)

    • Build regression models to predict optimal conditions

    • Validate with confirmation experiments

This approach has been demonstrated to achieve high levels (250 mg/L) of soluble functional recombinant protein expression in E. coli, which could be applied to SRII production to significantly improve yields over the reported 3-4 mg/L .

What are the molecular mechanisms underlying the different spectral and functional properties between SRII from H. salinarum and homologous proteins like pSRII from N. pharaonis?

The molecular differences between SRII from H. salinarum and pSRII from N. pharaonis include:

  • Schiff base environment: Resonance Raman spectroscopy reveals that SRII from H. salinarum has a strongly hydrogen-bonded Schiff base similar to mammalian rhodopsin, while pSRII from N. pharaonis shows a different hydrogen bonding pattern .

  • Photocycle kinetics: H. salinarum SRII exhibits characteristic prolonged photocycle kinetics compared to pSRII, which affects its signaling properties .

  • Key amino acid differences: Specific residues in the retinal binding pocket and proton translocation pathway contribute to these differences:

    • Positions D73, D103, and V106 have been identified as critical for signaling and pH response

    • Substitutions at these positions (D73E, D73N, D103N, and V106M) can significantly alter signaling properties

  • Hydrogen bonding network: Differences in the extensive hydrogen bonding network around the retinal Schiff base contribute to the distinct spectral properties and absorption maxima between the two homologs.

Understanding these molecular differences provides insights into the evolutionary adaptations of sensory rhodopsins to different ecological niches and cellular functions, and can guide protein engineering efforts to create rhodopsins with modified spectral and kinetic properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.