Recombinant Halobacterium salinarum Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
sdhD; sdhC; VNG_1310G; Succinate dehydrogenase hydrophobic membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Target Names
Target Protein Sequence
MSESYDRGLVADFGRWTEFSAGMWAWVFHKFTGWVLVGYLFTHISVLSTSLQGAQVYNST LSGLESLAIVRLLEVGLLAVAVFHILNGIRLLFVDLGVGLEAQDKSFYASLVLTGVIVVA SVPTFLTGAF
Uniprot No.

Target Background

Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH).
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of SdhD in Halobacterium salinarum?

SdhD in Halobacterium salinarum is a 130-amino acid hydrophobic membrane anchor subunit of succinate dehydrogenase with the sequence: MSESYDRGLVADFGRWTEFSAGMWAWVFHKFTGWVLVGYLFTHISVLSTSLQGAQVYNSTLSGLESLAIVRLLEVGLLAVAVFHILNGIRLLFVDLGVGLEAQDKSFYASLVLTGVIVVASVPTFLTGAF .

Unlike typical SdhD subunits in bacteria and eukaryotes, the H. salinarum SdhD exhibits unusual properties. Based on comparative studies with related archaea, SdhD in haloarchaea appears to lack the typical transmembrane α-helical regions present in other succinate:quinone reductases (SQRs) and quinol:fumarate reductases (QFRs) . This subunit likely contributes to the anchoring of the SDH complex to the membrane and may be involved in electron transport within the respiratory chain.

Interestingly, current research suggests that H. salinarum SdhD may contain a covalent heme attachment, potentially representing a novel type of cytochrome c in archaea . This feature appears to be unique to haloarchaea and may contribute to what researchers have termed the "Halobacterium paradox" .

How does the H. salinarum SDH complex differ from its bacterial and eukaryotic counterparts?

The SDH complex of H. salinarum shows several distinctive features compared to its counterparts in bacteria and eukaryotes:

FeatureH. salinarum/HaloarchaeaBacteriaEukaryotes
Subunit compositionSdhA, SdhB, SdhC, SdhDSdhA, SdhB, SdhC, SdhDSdhA, SdhB, SdhC, SdhD
Membrane anchoringPossibly single transmembrane segment in SdhC Multiple transmembrane helicesMultiple transmembrane helices
SdhD propertiesLacks typical transmembrane regions, possible heme attachment Contains 3-5 transmembrane helicesContains transmembrane regions
Iron-sulfur clustersS1 [2Fe2S], S2 [4Fe4S], possibly second [4Fe4S] instead of typical [3Fe4S] S1 [2Fe2S], S2 [4Fe4S], S3 [3Fe4S]S1 [2Fe2S], S2 [4Fe4S], S3 [3Fe4S]

These differences likely reflect adaptations to the extreme hypersaline environment where H. salinarum thrives, requiring structural modifications to maintain protein stability and function in high salt conditions .

What expression systems are commonly used for recombinant H. salinarum SdhD?

For recombinant expression of H. salinarum SdhD, researchers have employed several systems with varying degrees of success:

  • E. coli expression systems: While traditional bacterial expression systems can be used, they often yield limited functional protein due to the extreme halophilic nature of the native protein .

  • Haloferax volcanii expression: This related haloarchaeon has been successfully used as a host for expressing halophilic proteins, as demonstrated with other H. salinarum proteins . The H. volcanii H1209 strain has been shown to effectively express archaeal membrane proteins when cultured in Hv-Ca liquid medium at 43°C .

  • Native expression in H. salinarum: For studying the protein in its natural context, inducible expression systems in H. salinarum can be used, though genetic manipulation is more challenging than in model organisms .

The choice of expression system depends on research goals. For structural and functional studies requiring properly folded protein, expression in halophilic hosts is generally preferable, while high-yield applications may benefit from optimized E. coli systems with appropriate modifications.

What methodological approaches are most effective for purifying functional recombinant H. salinarum SdhD?

Purification of functional recombinant H. salinarum SdhD requires specialized protocols that account for its halophilic nature. Based on comparable studies with other haloarchaeal proteins, the following methodological approach is recommended:

  • Initial extraction conditions:

    • Use high-salt buffers (typically 2-4 M NaCl or KCl) throughout the purification process

    • Maintain pH 7.5-8.0 using Tris-HCl buffer systems (50 mM)

    • Include protease inhibitors to prevent degradation

  • Affinity chromatography:

    • For His-tagged constructs, use Ni-NTA or HisTrap HP columns with salt-containing binding buffers

    • Apply imidazole gradient elution (10-500 mM), with the protein typically eluting at 150-300 mM imidazole

    • Collect fractions and analyze by SDS-PAGE with heme staining to confirm the presence of covalently attached heme if applicable

  • Buffer exchange and concentration:

    • Use Amicon Ultra centrifugal filter units (10 kDa MWCO) at 3000× g, 4°C

    • Maintain high salt concentration (2 M NaCl) during concentration to prevent protein precipitation

  • Quality assessment:

    • Verify purity using SDS-PAGE (expected MW ~14 kDa)

    • Confirm functional integrity through spectroscopic analysis (UV-Vis for heme absorption at ~400 nm)

    • For complex assembly studies, blue native PAGE can assess integration with other SDH subunits

This protocol has been successfully adapted for other membrane proteins from H. salinarum and related haloarchaea with >80% recovery of functional protein .

How can researchers investigate the proposed novel heme attachment in H. salinarum SdhD?

The proposed novel heme attachment in H. salinarum SdhD represents an interesting research direction. To investigate this feature, researchers should consider the following methodological approach:

  • Spectroscopic characterization:

    • UV-visible spectroscopy to detect characteristic c-type cytochrome absorbance peaks (~552 nm)

    • Resonance Raman spectroscopy to identify heme coordination environment

    • EPR spectroscopy to characterize the electronic properties of the heme

  • Biochemical verification:

    • Heme staining after SDS-PAGE to confirm covalent attachment (resistant to SDS denaturation)

    • HPLC separation of peptides with dual monitoring at 280 nm (protein) and 400 nm (heme)

    • Mass spectrometry analysis of heme-containing peptides to identify the exact attachment site

  • Mutational analysis:

    • Site-directed mutagenesis of histidine residues (potential heme attachment sites)

    • Expression of mutant variants and assessment of heme incorporation

    • Functional assays to determine the importance of heme for SDH activity

  • Structural determination:

    • X-ray crystallography or cryo-EM to resolve the three-dimensional structure

    • Computational modeling based on homologous proteins

This integrative approach should clarify whether H. salinarum SdhD indeed contains a novel type of covalent heme attachment and how this feature relates to its function in the respiratory chain.

What experimental approaches can resolve the contradictory findings regarding the membrane topology of H. salinarum SdhD?

Current literature reveals contradictory findings regarding the membrane topology of H. salinarum SdhD, particularly concerning its hydrophobicity profile and transmembrane regions. To resolve these contradictions, researchers should consider the following complementary experimental approaches:

  • Computational prediction refinement:

    • Apply multiple topology prediction algorithms specifically trained on archaeal membrane proteins

    • Perform comparative analysis with confirmed structures of homologous proteins

    • Use molecular dynamics simulations to model behavior in high-salt environments

  • Biochemical mapping:

    • Cysteine scanning mutagenesis coupled with accessibility assays

    • Protease protection assays to identify exposed regions

    • Chemical labeling of accessible residues followed by mass spectrometry

  • Biophysical characterization:

    • Solid-state NMR to determine membrane-embedded regions

    • EPR spectroscopy with site-directed spin labeling to map topology

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

  • In vivo approaches:

    • Reporter fusion assays (e.g., PhoA, GFP) at different positions to determine cytoplasmic vs. periplasmic localization

    • Cross-linking studies to identify interactions with other membrane components

    • Proteoliposome reconstitution to assess functional orientation

The apparent lack of typical transmembrane α-helical regions in H. salinarum SdhD compared to other organisms may reflect a unique adaptation to the hypersaline environment or could indicate an alternative anchoring mechanism, possibly involving the interactions with other subunits of the SDH complex.

How does the iron-sulfur cluster composition in H. salinarum SDH compare to that in other organisms, and what methods can be used to characterize these differences?

Based on comparative studies with the related archaeon Sulfolobus acidocaldarius, the iron-sulfur cluster composition in H. salinarum SDH may differ from the typical arrangement found in bacteria and eukaryotes. While most organisms contain S1 [2Fe2S], S2 [4Fe4S], and S3 [3Fe4S] clusters, evidence suggests haloarchaea might possess a second [4Fe4S] cluster instead of the typical [3Fe4S] cluster .

To characterize these differences, the following methodological approaches are recommended:

  • Spectroscopic analysis:

    • EPR spectroscopy: Different iron-sulfur clusters exhibit characteristic EPR signals. The S1 [2Fe2S] cluster typically shows g values of ~2.02, 1.94, and 1.92, while the S2 [4Fe4S] cluster exhibits a signal at g ~2.05-1.86

    • Mössbauer spectroscopy: Provides detailed information about the oxidation states and local environments of iron atoms

    • Resonance Raman spectroscopy: Can differentiate between different types of Fe-S bonds

  • Sequence analysis:

    • Multiple sequence alignment of SdhB subunits to identify conserved cysteine residues that coordinate iron-sulfur clusters

    • Analysis of cluster-binding motifs, particularly focusing on the third cluster region

  • Mutagenesis studies:

    • Site-directed mutagenesis of cysteine residues in potential cluster-binding motifs

    • Functional assessment of mutant proteins to determine the importance of each cluster

  • Structural determination:

    • X-ray crystallography or cryo-EM to directly visualize the iron-sulfur clusters

    • Anomalous scattering to specifically locate iron atoms within the protein structure

Iron-Sulfur ClusterTypical OrganismsH. salinarum/ArchaeaDetection Method
S1 [2Fe2S]PresentPresentEPR (g ~2.02, 1.94, 1.92)
S2 [4Fe4S]PresentPresentEPR (g ~2.05-1.86)
S3 [3Fe4S]PresentPossibly absentEPR (g ~2.01)
Second [4Fe4S]AbsentPossibly presentEPR, sequence analysis

Understanding these differences is crucial for elucidating the electron transport mechanisms in archaeal SDH and may provide insights into evolutionary adaptations in extremophiles.

What is the relationship between the genomic context of the sdh operon in H. salinarum and its functional expression?

The genomic context of the sdh operon in H. salinarum provides valuable insights into its regulation and functional expression. According to the available research:

  • Operon structure and organization:

    • The H. salinarum sdh operon consists of four structural genes: sdhA, sdhB, sdhC, and sdhD

    • This organization resembles that found in many bacteria, suggesting functional conservation despite evolutionary distance

    • The sdh genes in H. salinarum are located on the main chromosome, not on either of the two minichromosomes (pNRC100 and pNRC200)

  • Transcriptional regulation:

    • The sdh operon in related archaea is transcribed as a single polycistronic mRNA

    • Transcription likely begins at the first base of the ATG start codon of the sdhA gene, as determined by primer extension methods in related archaea

    • In H. salinarum, transcription may be controlled by TrmB, a conserved transcription factor that regulates gluconeogenesis and other metabolic pathways

  • Genome-wide regulatory networks:

    • Post-transcriptional regulation may play a significant role, as studies indicate that 54% of all protein-coding genes in H. salinarum are targeted by multiple regulatory mechanisms

    • SmAP1 binding, asRNAs, and RNase_2099C have been implicated in post-transcriptional regulation of many genes in H. salinarum

  • Strain variations:

    • Different strains of H. salinarum (R1, DSM 3754T, NRC-1) show variations in their genomic content

    • These variations may lead to differences in expression patterns and functional properties of SDH between strains

Understanding this genomic context is essential for designing effective expression strategies and interpreting functional studies of the recombinant SdhD protein.

How can researchers effectively immobilize recombinant H. salinarum SdhD for industrial or analytical applications?

Immobilization of recombinant H. salinarum SdhD requires specialized approaches that account for its halophilic nature. Based on studies with other haloarchaeal enzymes, the following methodological approach is recommended:

  • Selection of appropriate support materials:

    • Celite 545 has shown high efficiency for immobilizing halophilic enzymes with retention of activity

    • Other potential supports include Immobead 150P and Lewatit VP OC1600, though with varying efficiencies

    • Hydrophobic supports may be particularly suitable given the membrane-associated nature of SdhD

  • Immobilization protocol:

    • Prepare the recombinant SdhD solution at 0.2-0.3 mg/mL in high-salt buffer (Tris-HCl 50 mM, pH 7.5, containing 2 M NaCl)

    • Mix the protein solution with the support material (70 mg support per 500 μL protein solution)

    • Incubate at 25°C with gentle agitation (150 rpm) for 24 h to allow adsorption

    • Wash the immobilized preparation three times with buffer to remove unbound protein

    • Dry the preparation at 30°C for 48 h or store in high-salt buffer for immediate use

  • Evaluation of immobilization efficiency:

    • Calculate immobilization yield based on protein concentration before and after the process

    • Assess activity retention using appropriate enzymatic assays

    • Determine operational stability under various conditions

  • Optimization considerations:

    • Salt concentration significantly affects immobilization efficiency and stability

    • pH optimization is critical, as immobilized halophilic enzymes often show shifted pH optima compared to free enzymes

    • Temperature stability may be enhanced upon immobilization

Support MaterialTypical Immobilization YieldActivity RetentionOptimal Salt ConcentrationReference
Celite 54575-90%60-85%2-5 M NaCl
Immobead 150P60-80%40-70%2-3 M NaCl
Lewatit VP OC160050-70%35-65%2-3 M NaCl

Immobilized H. salinarum SdhD may exhibit enhanced stability against inhibitors such as EDTA, BME, and PMSF, as observed with other halophilic enzymes , making it potentially valuable for applications requiring robust biocatalysts in extreme conditions.

What role might H. salinarum SdhD play in microbial adaptation to extreme environments, and how can this be experimentally investigated?

H. salinarum SdhD likely plays a crucial role in adaptation to extreme hypersaline environments. To experimentally investigate this role, researchers should consider a multi-faceted approach:

  • Comparative genomics and evolution:

    • Analyze SdhD sequences across halophilic, thermophilic, and mesophilic organisms to identify adaptive signatures

    • Calculate the ratio of acidic to basic amino acids, as halophilic proteins typically have excess acidic residues for stability in high salt

    • Perform phylogenetic analysis to trace the evolutionary history of SdhD adaptations

  • Structural adaptations:

    • Investigate the unique properties of H. salinarum SdhD, such as the potential novel heme attachment

    • Compare membrane topology and hydrophobicity profiles with non-halophilic homologs

    • Assess protein stability in varying salt concentrations through thermal denaturation studies

  • Functional characterization under extreme conditions:

    • Measure enzymatic activity of the SDH complex containing H. salinarum SdhD at different salt concentrations (1-5 M NaCl)

    • Evaluate electron transport efficiency under various stress conditions

    • Compare oxygen consumption rates in reconstituted systems with different SdhD variants

  • In vivo significance:

    • Generate knockout mutants and assess growth phenotypes under various stress conditions

    • Perform complementation studies with SdhD from non-halophilic organisms

    • Monitor metabolic flux through the TCA cycle in native vs. modified strains

  • Proteomic and interactomic approaches:

    • Identify interaction partners of SdhD under different environmental conditions

    • Analyze post-translational modifications that might regulate SdhD function

    • Perform quantitative proteomics to assess SdhD abundance in response to environmental changes

The unique properties of H. salinarum SdhD, particularly its potential heme attachment and unusual membrane interaction, may represent adaptations that enable efficient energy metabolism under extreme conditions. Understanding these adaptations could provide insights into the evolution of extremophiles and potentially inspire biomimetic applications in biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.