Recombinant Halobacterium sp. Archaerhodopsin-1 (bop)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Halobacterium sp. Archaerhodopsin-1 (aO-1) refers to the engineered expression of the archae-opsin protein encoded by the aop-1 gene from Halobacterium sp. Aus-1. While the term "bop" (bacterio-opsin) typically denotes the apoprotein of bacteriorhodopsin, it is sometimes conflated with archae-opsin nomenclature in literature . The protein forms a functional complex with retinal, enabling light-driven proton translocation across membranes.

Recombinant Expression and Production

aO-1 is heterologously expressed in E. coli using optimized vectors. Critical parameters include:

ParameterDetailSource
Host OrganismEscherichia coli (e.g., BL21(DE3))
Expression VectorpGEMEX2 (T7 promoter) or pET derivatives
Yield3–5% of total membrane proteins (comparable to bacterio-opsin)
PurificationDetergent solubilization (e.g., Triton X-100) followed by gel filtration
Chromophore IncorporationExogenous retinal supplementation required for activity

Key Challenge: Low expression levels in some systems necessitate fusion tags (e.g., T7 N-terminal tag) to enhance solubility .

Functional Characterization

aO-1 exhibits robust light-driven proton pumping activity when reconstituted into phospholipid liposomes. Functional benchmarks include:

PropertyValueSource
Proton Pumping EfficiencyComparable to native bacteriorhodopsin in purple membranes
WavelengthAbsorbs visible light (λ<sub>max</sub> ~560 nm)
pH SensitivityActivity retained under acidic to neutral conditions

Mechanism: Proton translocation occurs via a photocycle involving retinal isomerization, similar to bacteriorhodopsin but with distinct kinetic parameters .

Optogenetics and Biotechnology

aO-1 serves as a model for studying archaeal photoreceptors and optogenetic tools. Its compact structure and efficiency in heterologous systems make it suitable for:

  • Bioelectrochemical Systems: Integration into biofuel cells for light-driven energy conversion .

  • Structural Insights: Crystallographic studies to elucidate proton transfer mechanisms .

Comparative Biochemistry

aO-1’s recombinant expression highlights regulatory interactions absent in E. coli:

  • Carotenoid Metabolism: In Halobacterium, bacterio-opsin inhibits bacterioruberin biosynthesis to prioritize retinal synthesis. This regulation is lost in recombinant systems .

  • Gene Context: Flanking regions (e.g., brp and brz) modulate aop-1 expression in native hosts but are often omitted in recombinant constructs .

Challenges and Future Directions

  • Chromophore Limitation: Native retinal biosynthesis is absent in E. coli, requiring exogenous supplementation .

  • Operon Complexity: Native regulatory elements (e.g., brz) are not typically included in recombinant vectors, potentially affecting expression efficiency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing your desired tag.
Synonyms
bop; Archaerhodopsin-1; AR 1; Bacterio-opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
7-260
Protein Length
Full Length of Mature Protein
Species
Halobacterium sp. (strain SG1)
Target Names
bop
Target Protein Sequence
TAAVGADLLGDGRPETLWLGIGTLLMLIGTFYFIVKGWGVTDKEAREYYSITILVPGIAS AAYLSMFFGIGLTEVQVGSEMLDIYYARYADWLFTTPLLLLDLALLAKVDRVSIGTLVGV DALMIVTGLVGALSHTPLARYTWWLFSTICMIVVLYFLATSLRAAAKERGPEVASTFNTL TALVLVLWTAYPILWIIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTE APEPSAGAEASAAD
Uniprot No.

Target Background

Function
Light-driven proton pump. It may interact with bacterioruberin in the claret membrane.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Archaerhodopsin-1?

Archaerhodopsin-1 is a 260-amino acid integral membrane protein (mature protein spans residues 7-260) with a molecular mass of approximately 27,851 daltons. It contains seven transmembrane helices and a retinal chromophore covalently linked via a Schiff base. The protein shares 59% sequence homology with bacteriorhodopsin and 32% with halorhodopsin from Halobacterium halobium. Three charged residues (Asp-121, Asp-218, and Lys-222) are conserved in the transmembrane segments among these retinal proteins, suggesting their functional importance in proton pumping activity .

How does Archaerhodopsin-1 function as a proton pump?

Archaerhodopsin-1 functions as a light-driven proton pump similar to bacteriorhodopsin. Upon absorption of light, the all-trans retinal chromophore isomerizes to 13-cis configuration, initiating a photocycle that results in the translocation of protons across the membrane from the cytoplasmic to the extracellular side. The photocycle involves several spectroscopically distinct intermediates, during which proton transfer occurs through a series of key amino acid residues. Unlike bacteriorhodopsin, some archaerhodopsins (such as AR4) display an opposite temporal order of proton uptake and release at neutral pH, suggesting subtle but important differences in their proton-pumping mechanisms .

What are the key amino acid residues involved in the proton-pumping mechanism?

The proton-pumping function relies on several key conserved residues. The retinal Schiff base (RSB) forms with a conserved lysine residue (typically Lys-222 in archaerhodopsins). Asp-121 and Asp-218 are critical for the proton transfer pathway. The proton release complex typically involves glutamate residues on the extracellular side, while proton uptake on the cytoplasmic side involves aspartate residues. Mutations in these residues can significantly alter or abolish the proton-pumping activity, making them important targets for structure-function studies .

What expression systems are effective for producing recombinant Archaerhodopsin-1?

Two main expression systems have proven effective for recombinant Archaerhodopsin-1:

  • E. coli expression system: Allows for high-yield expression of recombinant AR1 with an N-terminal His-tag. This system is advantageous for producing protein for structural studies and when specific mutations are required .

  • Halobacterium salinarum L33 expression system: Provides a more native-like environment for AR1 expression, with yields of up to 20 mg/L. This system is particularly valuable when studying the protein in a context that includes native lipids and maintaining proper trimeric organization .

The choice between these systems depends on the specific research questions and downstream applications.

What are the optimal conditions for purifying recombinant Archaerhodopsin-1?

For purification of His-tagged recombinant AR1 from E. coli, the following method is recommended:

  • Lyse cells in a Tris/PBS-based buffer (pH 8.0)

  • Perform immobilized metal affinity chromatography using the His-tag

  • Apply a gradient elution with increasing imidazole concentration

  • Dialyze against a Tris/PBS-based buffer containing 6% trehalose (pH 8.0)

  • Store as a lyophilized powder or in solution with 50% glycerol at -20°C/-80°C

For native-like AR1 from halophilic expression systems, purification should be performed in high-salt buffers (>2M NaCl) to maintain protein stability, and detergent-free methods can be employed when maintaining the native membrane environment is desired .

How can researchers optimize retinal incorporation for functional Archaerhodopsin-1?

For functional Archaerhodopsin-1, proper retinal incorporation is essential. Researchers should:

  • Add all-trans retinal during expression (typically 5-10 μM final concentration)

  • Ensure expression occurs under dim light conditions to prevent premature photocycling

  • Monitor retinal incorporation by measuring the absorbance ratio A280/A550

  • For E. coli expression systems, supplement the growth medium with retinal or add it during protein solubilization

  • For halophilic expression systems, native retinal biosynthesis generally provides sufficient chromophore

A functional protein will exhibit a characteristic absorption peak at approximately 550-570 nm, with the exact wavelength dependent on the specific protein variant and its environment .

What spectroscopic techniques are most informative for studying Archaerhodopsin-1?

Multiple spectroscopic techniques provide complementary information about AR1 structure and function:

TechniqueInformation ObtainedApplication in AR1 Research
UV-Vis AbsorptionChromophore state, photocycle intermediatesMonitoring protein folding, retinal isomerization states
Fluorescence SpectroscopyQuantum yield, fluorescence lifetimesEvaluating AR1 variants for voltage sensing applications
FTIR SpectroscopyProtein structural changes, protonation statesCharacterizing structural changes during photocycle
Resonance Raman SpectroscopyRetinal configuration, Schiff base interactionsDetermining retinal isomerization states
Solid-state NMRDetailed structural information, dynamicsInvestigating trimeric packing and protein-lipid interactions

These techniques are particularly valuable when used in combination to provide a comprehensive view of AR1 photophysics and photochemistry .

How can researchers characterize the photocycle of Archaerhodopsin-1?

To characterize the AR1 photocycle, researchers should:

  • Perform time-resolved UV-Vis spectroscopy using laser flash photolysis

  • Track the formation and decay of photocycle intermediates (typically K, L, M, N, and O states)

  • Measure pH dependence of photocycle kinetics

  • Compare photocycle kinetics at different temperatures to determine activation energies

  • Use site-directed mutants to identify key residues involved in specific photocycle transitions

  • Combine spectroscopic measurements with photoelectric current measurements to correlate spectral changes with proton movement

A comprehensive photocycle analysis should include determination of rate constants for each transition and identification of the rate-limiting step in the proton pumping process .

What factors affect the fluorescence properties of Archaerhodopsin variants?

Several factors influence the fluorescence properties of Archaerhodopsin variants:

  • Mutations around the retinal Schiff base: Modifications to residues near the retinal binding pocket can dramatically increase fluorescence quantum yield

  • Schiff base counterion mutations: Altering the protonated Schiff base counterion can extend the fluorescence excited state lifetime

  • pH: The protonation state of key residues affects fluorescence intensity and spectral properties

  • Membrane voltage: Membrane potential changes can alter fluorescence intensity, enabling voltage sensing applications

  • Excitation wavelength: Different excitation wavelengths can access varying fluorescent states, with far-red excitation often being most effective

Recent directed evolution approaches have specifically targeted increased fluorescence, with mutations concentrated near the retinal chromophore having the most significant effects .

How can Archaerhodopsin-1 be optimized for voltage sensing in neurons?

Optimizing AR1 for voltage sensing applications requires several considerations:

  • Fluorescence enhancement: Introduce mutations identified through directed evolution to increase baseline fluorescence, particularly those affecting the retinal-binding pocket

  • Spectral tuning: Select variants with red-shifted absorption/emission for better tissue penetration and reduced phototoxicity

  • Membrane trafficking: Add trafficking sequences (such as TS, ER export, or Golgi export motifs) to improve surface expression in mammalian cells

  • Coupling to fluorescent proteins: For FRET-based sensors, optimize the linker length and orientation between AR1 and partner fluorophores

  • Response kinetics: Select variants with rapid voltage-dependent fluorescence changes to capture fast neuronal activity

  • Reduced photocurrent: Minimize proton pumping activity through specific mutations to avoid perturbing neuronal physiology during imaging

Mutations that increase fluorescence while preserving voltage sensitivity are particularly valuable. The approach used for Archaerhodopsin-3 (introducing mutations around the retinal Schiff-base linkage) could be applied to AR1 with appropriate modifications based on sequence homology .

What are the advantages and limitations of using Archaerhodopsin-1 compared to other optogenetic tools?

Archaerhodopsin-1 offers several advantages and limitations as an optogenetic tool:

Advantages:

  • Functions as both an optical actuator (proton pump) and sensor (voltage indicator)

  • Does not require additional cofactors beyond retinal, which is abundant in mammalian tissues

  • Can be genetically targeted to specific cell types

  • Has a fast photocycle suitable for monitoring rapid neuronal events

  • Contains a single protein component (unlike multi-component systems)

Limitations:

  • Relatively dim fluorescence compared to conventional fluorescent proteins

  • Potential interference between sensing and actuation functions

  • Proton pumping activity may alter cellular physiology during prolonged imaging

  • Limited spectral diversity compared to other fluorescent voltage indicators

  • Requires intense illumination, potentially causing phototoxicity

Researchers should weigh these factors when selecting AR1 variants for specific optogenetic applications .

What directed evolution strategies have proven successful for improving Archaerhodopsin properties?

Successful directed evolution strategies for archaerhodopsins include:

  • Random mutagenesis: Using error-prone PCR to generate libraries with mutations throughout the protein

  • Targeted mutagenesis: Focusing on residues near the retinal chromophore

  • Screening approaches:

    • Fluorescence-activated cell sorting (FACS) to isolate brighter variants

    • High-throughput automated microscopy screening

    • Plate reader-based assays for spectral properties

  • Iterative improvement: Combining beneficial mutations and repeating the selection process

  • Cross-species knowledge transfer: Applying mutations found in related rhodopsins (e.g., transferring mutations from Gloeobacter violaceus rhodopsin to archaerhodopsins)

These approaches have yielded variants with significantly enhanced fluorescence quantum yield and red-shifted spectral properties, particularly when mutations were concentrated around the retinal binding pocket .

Which specific amino acid residues are most critical for modifying Archaerhodopsin-1 function?

Several key residues have been identified as critical for modifying archaerhodopsin function:

  • Retinal pocket residues: Mutations near the retinal chromophore significantly affect spectral properties and fluorescence

  • Schiff base counterion: Typically Asp-95 (homologous to Asp-85 in bacteriorhodopsin), influences proton pumping and spectral tuning

  • Proton release group: Typically includes glutamate residues on the extracellular side

  • Proton uptake site: Usually Asp-96 in bacteriorhodopsin and homologous residues in archaerhodopsins

  • Conserved charged residues: Asp-121, Asp-218, and Lys-222 are conserved across microbial rhodopsins and critical for function

Mutations in these regions can modify proton pumping efficiency, spectral properties, fluorescence quantum yield, and photocycle kinetics. The most dramatic improvements in fluorescence have come from mutations directly interacting with the chromophore .

How can researchers effectively analyze and interpret mutagenesis data for structure-function relationships?

Effective analysis of mutagenesis data for structure-function relationships requires a systematic approach:

  • Structural mapping: Map mutations onto available crystal structures to identify spatial patterns

  • Sequence conservation analysis: Compare effects of mutations at conserved versus variable positions

  • Chemical property categorization: Group mutations by changes in charge, hydrophobicity, size, etc.

  • Functional parameter correlation: Correlate spectral shifts, photocycle kinetics, and fluorescence properties

  • Molecular dynamics simulations: Use computational approaches to predict effects of mutations on protein dynamics

  • Integration with spectroscopic data: Combine mutagenesis results with FTIR, NMR, and other spectroscopic data

For archaerhodopsins, analysis has revealed that mutations affecting direct interactions between the chromophore and protein have the most pronounced effects on fluorescence and spectral properties. Such comprehensive analysis enables rational design of new variants with desired properties .

How does Archaerhodopsin-1 compare structurally and functionally to bacteriorhodopsin?

Archaerhodopsin-1 and bacteriorhodopsin share significant structural and functional similarities but also display important differences:

Similarities:

  • Both function as light-driven proton pumps

  • Both contain seven transmembrane helices and a retinal chromophore

  • Share 59% sequence homology

  • Contain conserved charged residues critical for proton transport (Asp-121, Asp-218, and Lys-222)

  • Undergo similar photocycle with spectrally distinct intermediates

Differences:

  • Different crystallization properties and trimeric organization

  • Some archaerhodopsins show opposite temporal order of proton uptake and release

  • Distinct spectral tuning properties and absorption maxima

  • Different responses to pH and salt concentration

  • Variations in the proton release complex on the extracellular side

These similarities and differences provide valuable insights into the fundamental mechanisms of light-driven proton pumping and can guide the engineering of rhodopsin variants with specific properties .

What unique properties distinguish Archaerhodopsin-1 from other archaeal rhodopsins?

Archaerhodopsin-1 possesses several distinctive properties compared to other archaeal rhodopsins:

  • Sequence characteristics: AR1 has specific sequence features that distinguish it from other archaerhodopsins (AR2, AR3, AR4)

  • Spectral properties: Slight differences in absorption maxima and photocycle kinetics

  • Trimeric organization: Forms stable trimers in the membrane, similar to but distinct from other archaerhodopsins

  • Expression properties: Different expression characteristics in heterologous systems

  • pH dependencies: Unique pH-dependent properties affecting proton pumping and spectral characteristics

Understanding these distinctive properties is crucial for selecting the most appropriate archaerhodopsin variant for specific research applications and for engineering new variants with desired combinations of properties .

How can knowledge from different rhodopsin families be leveraged to improve Archaerhodopsin-1 for specific applications?

Cross-family knowledge transfer has proven valuable for improving archaerhodopsins:

  • Structural insights: Crystal structures from diverse rhodopsins provide a framework for identifying critical residues

  • Functional motifs: Identifying conserved functional elements across rhodopsin families

  • Spectral tuning: Applying known spectral tuning mutations from one rhodopsin to another

  • Transferable mutations: Mutations that enhance properties in one rhodopsin can often be transferred to homologous positions in another

  • Chimeric approaches: Creating fusion proteins incorporating beneficial domains from different rhodopsins

How do lipid-protein interactions influence the function and stability of Archaerhodopsin-1?

Lipid-protein interactions significantly impact archaerhodopsin function and stability:

  • Trimeric organization: Native lipids facilitate the formation and stability of AR1 trimers

  • Functional modulation: Specific lipids can modulate photocycle kinetics and proton pumping efficiency

  • Spectral tuning: Lipid environment influences absorption and fluorescence properties

  • Structural stability: Native-like lipid environments enhance thermal stability

  • Associated carotenoids: Bacterioruberin and other membrane carotenoids can interact with and stabilize archaerhodopsins

Advanced techniques such as solid-state NMR, FTIR spectroscopy, and dynamic light scattering have been employed to investigate these interactions. Research has shown that maintaining archaerhodopsins in native-like lipid environments can preserve functional properties that may be lost in detergent-solubilized preparations .

What role do water molecules play in the proton transport mechanism of Archaerhodopsin-1?

Water molecules are critical components of the proton transport mechanism in archaerhodopsins:

  • Hydrogen-bonded networks: Internal water molecules form hydrogen-bonded networks that facilitate proton transport

  • Proton wire: Water molecules serve as components of the proton wire connecting key amino acid residues

  • Conformational flexibility: Hydration affects protein conformational dynamics during the photocycle

  • Spectral tuning: Water molecules near the retinal Schiff base influence spectral properties

  • Desensitization mechanisms: Modification of internal hydrogen-bonded water networks is associated with desensitization

High-resolution crystal structures of archaerhodopsins have revealed that desensitization occurs when internal hydrogen-bonded water networks are modified. These water molecules are not simply passive components but active participants in the proton transport mechanism .

What are the current challenges and future directions in Archaerhodopsin-1 research?

Current challenges and future directions in AR1 research include:

  • Improving fluorescence quantum yield: Further enhancing brightness for voltage sensing applications

  • Spectral diversification: Developing variants with distinct spectral properties for multiplexed imaging

  • Reducing photocurrent: Creating "non-pumping" variants that maintain voltage sensitivity without perturbing cellular physiology

  • Structure-function relationships: Obtaining more high-resolution structures of photocycle intermediates

  • Computational modeling: Developing improved models of proton transport mechanisms

  • Application expansion: Exploring use in additional biological systems beyond neurons

  • Long-term stability: Enhancing protein stability for extended imaging experiments

  • Combining properties: Integrating optimal fluorescence, spectral properties, and voltage sensitivity in single variants

Addressing these challenges will require interdisciplinary approaches combining structural biology, spectroscopy, molecular dynamics simulations, protein engineering, and advanced imaging techniques .

What are the optimal protocols for reconstituting Archaerhodopsin-1 in artificial membrane systems?

For optimal reconstitution of AR1 in artificial membrane systems:

  • Liposome preparation:

    • Use a mixture of DOPC/DOPE/DOPS (70:15:15) for mammalian-like membranes

    • For halophile-like conditions, include archaeal lipids or synthetic equivalents

    • Prepare lipids by thin-film hydration followed by extrusion through 100 nm filters

  • Protein incorporation:

    • Maintain a lipid-to-protein ratio of 100:1 to 50:1 (w/w)

    • Use gentle detergent removal via dialysis or Bio-Beads

    • Perform reconstitution under dim red light to prevent photocycling

    • Monitor successful incorporation by absorption spectroscopy

  • Functional verification:

    • Measure light-induced pH changes to confirm proton pumping

    • Perform patch-clamp experiments to quantify photocurrents

    • Use fluorescence correlation spectroscopy to verify protein mobility

This protocol maintains protein function while providing a controlled environment for mechanistic studies .

How can researchers troubleshoot common issues with Archaerhodopsin-1 expression and purification?

Common issues and troubleshooting approaches for AR1 expression and purification:

IssuePossible CausesTroubleshooting Approaches
Low expression yieldPoor codon optimization, protein toxicityOptimize codons, use inducible promoters, reduce expression temperature
Improper foldingInsufficient retinal, improper membrane insertionIncrease retinal concentration, optimize membrane targeting sequences
Loss of absorbance during purificationSchiff base hydrolysis, protein denaturationAdjust pH, add retinal during purification, use gentle detergents
AggregationImproper detergent selection, low salt concentrationScreen multiple detergents, maintain high salt for halophilic proteins
Poor purityNon-specific binding to purification resinOptimize imidazole gradient, add additional purification steps
Loss of functionDetergent effects, lipid removalUse lipid-like detergents, add lipids during purification

For recombinant AR1, repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for up to one week. Long-term storage is best achieved with lyophilized protein or in solution with 50% glycerol at -20°C/-80°C .

What are the key considerations for designing experiments to measure the photocycle kinetics of Archaerhodopsin-1?

Key considerations for measuring AR1 photocycle kinetics include:

  • Sample preparation:

    • Protein concentration (typically 0.2-0.5 OD at absorption maximum)

    • Buffer composition (pH, salt concentration)

    • Sample homogeneity (avoid aggregation)

  • Experimental setup:

    • Light source (laser or LED with appropriate wavelength)

    • Flash duration (shorter than the fastest photocycle transition)

    • Probe light (minimal actinic effect)

    • Time resolution (nanoseconds to seconds coverage)

  • Data analysis:

    • Multi-exponential fitting

    • Global analysis methods

    • Photocycle modeling

    • Temperature dependence for activation energies

  • Control experiments:

    • pH dependence

    • Salt concentration effects

    • Comparison with known rhodopsin standards

    • Verification with multiple techniques (absorption, FTIR, electrical)

Combining these considerations ensures reliable and reproducible photocycle measurements that can be compared across different experimental conditions and protein variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.