Recombinant Halobacterium sp. Archaerhodopsin-2

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Halobacterium sp. Archaerhodopsin-2

Recombinant Halobacterium sp. Archaerhodopsin-2 (AR2) is a genetically engineered variant of the light-driven proton pump natively produced by Halobacterium sp. aus-2. This archaeal retinal protein belongs to the microbial rhodopsin superfamily and shares 56% sequence identity with bacteriorhodopsin (bR) . Produced via heterologous expression in Escherichia coli, recombinant AR2 retains its functional properties, including retinal binding and proton-pumping activity . Its primary role involves converting light energy into a transmembrane proton gradient, which can be harnessed for ATP synthesis or optogenetic applications .

Functional Properties and Proton Pumping Mechanism

AR2 functions as a light-activated proton pump, extruding H⁺ ions from the cytoplasm under illumination. Key functional attributes include:

  • Photocycle Kinetics: Absorption of light triggers retinal isomerization (all-trans → 13-cis), initiating conformational changes that facilitate proton transport .

  • Proton Pumping Efficiency: Reconstituted AR2 in phosphatidylcholine liposomes demonstrates light-driven H⁺ extrusion comparable to native bacteriorhodopsin .

  • pH Sensitivity: Proton-pumping activity is optimal under high salinity (>3 M KCl) and neutral pH conditions .

Biochemical Production and Purification

Recombinant AR2 is produced in E. coli using plasmid vectors under the control of inducible promoters (e.g., T7 or trc). Critical production parameters:

ParameterDetailSource
Expression SystemE. coli BL21(DE3) with pGEMEX2-derived plasmids
Yield3–5% of total membrane proteins
PurificationDetergent solubilization (e.g., DDM) followed by Ni-NTA chromatography
Purity>85% (SDS-PAGE)
Chromophore RegenerationRequires exogenous retinal incubation (≥20 µM) for functional reconstitution

The mature protein lacks the N-terminal leader sequence (cleaved post-translationally) and forms a purple pigment upon retinal binding .

Key Applications:

  • Optogenetics: Though less commonly used than AR3, AR2’s proton-pumping activity has potential for neuronal silencing via hyperpolarization .

  • Membrane Protein Studies: Serves as a model for probing proton transport mechanisms in extremophiles .

Notable Findings:

  • Gene Cloning: The aop2 gene (780 bp) was sequenced and cloned in 1989, revealing 88% identity to AR1 and 56% to bR .

  • Structural Insights: Trimeric architecture and bacterioruberin interactions were resolved to 1.8 Å resolution using X-ray crystallography .

  • Functional Reconstitution: Recombinant AR2 regenerated in E. coli membranes exhibits photocycle kinetics indistinguishable from native protein .

Comparative Analysis with Wild-Type Archaerhodopsin-2

PropertyWild-Type AR2Recombinant AR2
SourceHalobacterium sp. aus-2 claret membraneE. coli expression systems
Expression LevelNative membrane protein (~50% surface area)3–5% of total membrane proteins
Post-Translational ModificationsPyroglutamate formation at N-terminusRetains modifications when expressed in E. coli
Proton PumpingLight-dependent, Mg²⁺-enhanced activityFunctional after reconstitution in liposomes

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Archaerhodopsin-2; AR 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
7-259
Protein Length
Full Length of Mature Protein
Species
Halobacterium sp. (strain aus-2)
Target Protein Sequence
QAGFDLLNDGRPETLWLGIGTLLMLIGTFYFIARGWGVTDKEAREYYAITILVPGIASAA YLAMFFGIGVTEVELASGTVLDIYYARYADWLFTTPLLLLDLALLAKVDRVTIGTLIGVD ALMIVTGLIGALSKTPLARYTWWLFSTIAFLFVLYYLLTSLRSAAAKRSEEVRSTFNTLT ALVAVLWTAYPILWIVGTEGAGVVGLGIETLAFMVLDVTAKVGFGFVLLRSRAILGETEA PEPSAGADASAAD
Uniprot No.

Target Background

Function
Archaerhodopsin-2 is a light-driven proton pump found in Halobacterium sp. It may interact with bacterioruberin in the claret membrane.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Archaerhodopsin-2 and how does it differ from other archaeal rhodopsins?

Archaerhodopsin-2 is a retinal protein isolated from Halobacterium sp. aus-2 that functions as a light-driven proton pump. While it belongs to the archaeal rhodopsin family, Arch-2 exhibits distinct characteristics that differentiate it from bacteriorhodopsin (bR) and the original archaerhodopsin (Arch-1). The protein consists of 259 amino acids with a molecular mass of approximately 27,937 Da and is encoded by a gene comprising 780 base pairs .

Structurally, Arch-2 shares 56% amino acid sequence identity with bacteriorhodopsin and 88% with archaerhodopsin-1, although there are several small gaps in the sequence alignments . Despite these differences, Arch-2 maintains comparable proton-pumping efficiency in response to light. A significant distinction is that while the amino acid sequence of archaerhodopsin-1 revealed 157 conserved residues common to bacteriorhodopsin, Arch-2 reduces that number to 133, with 38 of these also being common to chloride pumps and 24 to all bacterial retinal proteins documented at the time of its characterization .

Which amino acid residues are essential for the proton-pumping function of Archaerhodopsin-2?

The proton-pumping function of Archaerhodopsin-2 depends on specific conserved amino acid residues that are critical for its activity. While direct experimental data on Arch-2 is limited in the search results, insights can be drawn from related archaeal rhodopsins such as Archaerhodopsin-3 (Arch-3).

In Arch-3, the protonation state of key residues like D95 and D222 (counterion to the retinal Schiff base) plays a crucial role in proton transport . For Arch-2, the conserved aspartic acid residues in analogous positions are likely equally important for its function. The conserved amino acids shared between Arch-2 and other proton pumps (133 residues in common with bacteriorhodopsin) form the core functional machinery for proton translocation .

Additionally, residues that interact with the retinal chromophore and those that form the proton translocation pathway are essential for proper function. The specific subset of 24 amino acids that Arch-2 shares with all known bacterial retinal proteins likely represents the most critical residues for basic functionality .

How can researchers effectively characterize the spectroscopic properties of Archaerhodopsin-2?

Characterizing the spectroscopic properties of Archaerhodopsin-2 requires a multi-technique approach similar to that used for other archaeal rhodopsins. Based on methodologies used for related proteins, researchers should:

  • UV/Visible Absorption Spectroscopy: Record dark-adapted and light-adapted spectra using a spectrophotometer. For dark adaptation, incubate samples in darkness for at least 1 hour prior to measurement. For light adaptation, illuminate samples with an appropriate wavelength laser (e.g., 532 nm at 5 mW) for approximately 10 minutes before measurement .

  • Resonance Raman Spectroscopy: Utilize Raman spectroscopy with 785 nm and 532 nm excitation to analyze vibrational modes of the retinal chromophore, particularly focusing on the C═C ethylenic stretch region (~1527 cm⁻¹) and the C═N Schiff base stretch region, which provide insights into the chromophore configuration and environment .

  • Fluorescence Spectroscopy: Measure excitation and emission spectra using a spectrofluorometer to assess the fluorescence properties of the protein. This is particularly important if Arch-2 is being evaluated for potential use as a fluorescent voltage indicator .

Sample preparation typically involves solubilizing the purified protein in an appropriate buffer (e.g., Tris buffer containing 10 mM Tris, 200 mM NaCl, 0.15% n-Decyl-β-D-maltopyranoside, pH 6.5) . For all spectroscopic measurements, using a consistent sample size (e.g., 300 μL) ensures reproducibility.

What expression systems are most suitable for recombinant Archaerhodopsin-2 production?

For effective recombinant Archaerhodopsin-2 production, bacterial expression systems, particularly Escherichia coli, offer a practical approach. When expressing Arch-2 in E. coli, researchers should consider:

  • Expression Vector Selection: Vectors containing strong, inducible promoters (such as T7) are recommended for controlled expression. The vector should include appropriate selection markers and tags to facilitate purification.

  • Host Strain Optimization: E. coli strains such as BL21(DE3) or C41(DE3), which are designed for membrane protein expression, provide better yields for rhodopsin proteins . These strains are deficient in certain proteases that might otherwise degrade the recombinant protein.

  • Culture Conditions: Growth at lower temperatures (20-25°C) after induction can improve proper folding. Supplementation with all-trans-retinal (typically 5-10 μM) is essential, as E. coli does not naturally produce this chromophore necessary for functional rhodopsin .

  • Induction Protocol: Inducing expression when cultures reach mid-log phase (OD₆₀₀ = 0.6-0.8) with appropriate IPTG concentration (typically 0.1-0.5 mM) and continuing expression for 4-24 hours optimizes protein yield.

Alternatively, for certain applications, archaeal host systems may be considered. The approach used for halorhodopsin overexpression in Natronomonas pharaonis, where a mutation in a bacteriorhodopsin activator homolog led to constitutive expression, suggests potential strategies for improving Arch-2 expression in native-like environments .

What purification strategies yield high-quality recombinant Archaerhodopsin-2?

Purifying recombinant Archaerhodopsin-2 to high quality requires a strategic multi-step approach:

  • Membrane Isolation: Following cell lysis, membranes containing the rhodopsin protein should be isolated by ultracentrifugation. A simplified approach inspired by methods used for halorhodopsin can involve washing cells with distilled water to create osmotic shock, helping to enrich the membrane fraction with the target protein .

  • Detergent Solubilization: Solubilize membrane-embedded Arch-2 using mild detergents such as n-Decyl-β-D-maltopyranoside (DM) at 0.15-0.2% concentration. Other detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS may also be effective but should be optimized for Arch-2 specifically .

  • Affinity Chromatography: If Arch-2 is expressed with an affinity tag (His-tag, FLAG-tag, etc.), use the corresponding affinity chromatography as the initial purification step. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) with Ni-NTA resin is commonly employed.

  • Size Exclusion Chromatography: As a final polishing step, size exclusion chromatography separates the properly folded, detergent-solubilized protein from aggregates and other impurities.

  • Quality Assessment: Verify protein purity using SDS-PAGE and Western blotting. Confirm functionality through spectroscopic analysis, ensuring the characteristic absorption spectrum with maxima at the expected wavelength for Arch-2.

Throughout the purification process, it's critical to maintain the protein in buffer containing the appropriate detergent concentration to prevent aggregation, typically in a buffer system such as 10 mM Tris, 200 mM NaCl with 0.15% detergent at pH 6.5-7.5 .

How can researchers assess the functional integrity of purified Archaerhodopsin-2?

Assessing the functional integrity of purified Archaerhodopsin-2 involves multiple complementary approaches:

  • Absorption Spectroscopy: A properly folded Arch-2 should exhibit characteristic absorption spectra with distinct peaks. Compare the spectral properties to established values for Arch-2. The presence of a clear absorption maximum in the expected range indicates proper chromophore incorporation and protein folding .

  • Proton Pumping Assay: For functional assessment, reconstitute Arch-2 into liposomes and measure light-induced pH changes in the external medium using a pH electrode or pH-sensitive dyes. Active proton pumping upon illumination confirms functional integrity.

  • Thermal Stability Assessment: Monitoring the protein's absorption spectrum at increasing temperatures can provide insights into its stability. A gradual and consistent shift in absorption properties with temperature, rather than sudden changes, generally indicates a well-folded protein.

  • Resonance Raman Spectroscopy: Analyze the vibrational modes of the retinal chromophore, particularly focusing on the C═C ethylenic stretch and C═N Schiff base stretch regions. For Arch-2, like other archaeal rhodopsins, these measurements provide detailed information about chromophore conformation and protein-chromophore interactions .

  • Photocycle Kinetics: Use time-resolved absorption spectroscopy to measure the photocycle kinetics of Arch-2. The presence of distinct photointermediates with appropriate lifetimes indicates proper functional dynamics of the protein.

By combining these approaches, researchers can comprehensively assess not only the structural integrity but also the functional capacity of purified Arch-2 samples.

How can researchers experimentally measure the proton-pumping activity of Archaerhodopsin-2?

Measuring the proton-pumping activity of Archaerhodopsin-2 requires specialized experimental setups that can detect light-induced pH changes:

  • Liposome Reconstitution Method:

    • Reconstitute purified Arch-2 into liposomes at a protein-to-lipid ratio of approximately 1:100 (w/w).

    • Suspend the proteoliposomes in a weakly buffered solution containing appropriate salt concentration (e.g., 100 mM NaCl).

    • Monitor pH changes in the external medium using a sensitive pH electrode or pH-sensitive fluorescent dyes.

    • Illuminate the sample with light matching the absorption maximum of Arch-2, and record the resulting pH decrease (due to proton pumping from inside to outside).

    • Confirm specificity by adding protonophores like CCCP, which should collapse the proton gradient and abolish the signal.

  • Whole-Cell Electrophysiology:

    • Express Arch-2 in appropriate cellular systems (mammalian cells or Xenopus oocytes).

    • Use patch-clamp techniques to measure light-induced outward currents under voltage clamp.

    • Vary the extracellular pH and membrane potential to characterize the dependence of pumping activity on these parameters.

  • pH-Sensitive Fluorescent Protein Coupling:

    • Engineer fusion constructs of Arch-2 with pH-sensitive fluorescent proteins.

    • Express these constructs in cells and monitor local pH changes around the protein upon illumination.

    • This approach allows for spatially resolved measurements of proton-pumping activity.

For all methods, include proper controls with non-functional Arch-2 mutants or samples lacking retinal to distinguish specific proton-pumping activity from other light-induced effects.

What approaches reveal the photocycle dynamics of Archaerhodopsin-2?

The photocycle dynamics of Archaerhodopsin-2 can be investigated using several complementary techniques:

  • Time-Resolved Absorption Spectroscopy:

    • Use laser flash photolysis systems with microsecond to millisecond time resolution.

    • Monitor absorption changes across a wide spectral range (350-700 nm) following a short laser flash.

    • Identify photocycle intermediates by their characteristic absorption spectra and kinetics.

    • Analyze the data using global fitting approaches to determine the sequence and lifetimes of intermediates.

  • Resonance Raman Spectroscopy:

    • Perform time-resolved Raman measurements to track structural changes in the retinal chromophore during the photocycle.

    • Focus particularly on the C═C ethylenic stretch mode (~1527 cm⁻¹ for the ground state) and C═N Schiff base stretch modes, which provide information about chromophore configuration and protonation state .

    • Compare with known values for related proteins like bacteriorhodopsin, where the ground state (G-state) shows a C═C band at 1528 cm⁻¹ and the O-intermediate at 1508 cm⁻¹ .

  • FTIR Difference Spectroscopy:

    • Record light-induced FTIR difference spectra to detect structural changes in both the protein and chromophore during the photocycle.

    • Use low-temperature trapping to stabilize specific photointermediates.

    • Identify key residues involved in proton transfer by analyzing characteristic vibrational bands.

  • Ultrafast Spectroscopy:

    • Employ femtosecond to picosecond spectroscopy to characterize the earliest events in the photocycle.

    • Track the initial isomerization of the retinal chromophore and subsequent protein responses.

The photocycle analysis should identify key intermediates analogous to the K, L, M, N, and O intermediates observed in bacteriorhodopsin, with particular attention to the specific kinetics and spectral properties unique to Arch-2.

How do environmental factors influence the functionality of Archaerhodopsin-2?

The functionality of Archaerhodopsin-2 is significantly influenced by various environmental factors that researchers should carefully control and monitor:

By systematically characterizing these environmental dependencies, researchers can optimize conditions for specific applications and gain deeper insights into the molecular mechanisms of Arch-2 function.

How can site-directed mutagenesis be used to engineer improved variants of Archaerhodopsin-2?

Site-directed mutagenesis offers powerful opportunities for engineering Archaerhodopsin-2 variants with enhanced or altered properties. Based on approaches used for related archaerhodopsins, researchers should consider:

A systematic approach should combine rational design (based on structural knowledge and comparison with related proteins) with screening of libraries of variants for desired properties. The table below summarizes potential mutation strategies based on successful approaches with Archaerhodopsin-3:

Mutation StrategyTarget ResiduesExpected OutcomePotential Application
Counterion modificationAsp95 equivalentSpectral shift, altered pKaRed-shifted voltage sensors
Retinal pocket tuningResidues near chromophoreModified absorption spectrumOptogenetic tools with different activation wavelengths
Proton transfer pathwayResidues in proton translocation channelAltered kineticsTemporally optimized optogenetic actuators
Surface mutationsExposed residuesImproved stability, reduced aggregationEnhanced expression and purification yield
Conformation stabilizationResidues that stabilize O-stateEnhanced fluorescenceImproved voltage sensors

What are the potential applications of Archaerhodopsin-2 in optogenetics and neuroscience research?

Archaerhodopsin-2 offers several promising applications in optogenetics and neuroscience research, leveraging its unique properties as a light-driven proton pump:

  • Neural Silencing Tools:

    • Arch-2 can hyperpolarize neurons when activated with light, enabling precise temporal inhibition of neural activity.

    • Compared to other inhibitory opsins, Arch-2 may offer advantages in spectral properties or kinetics that make it suitable for specific experimental paradigms.

    • Potential applications include dissecting neural circuit function, studying the role of specific neurons in behavior, and developing therapeutic approaches for hyperexcitability disorders.

  • Dual-Wavelength Optogenetic Control:

    • When used in combination with channelrhodopsins that activate at different wavelengths, Arch-2 can enable bidirectional control of neural activity.

    • This allows researchers to both activate and inhibit the same population of neurons with precise temporal control.

  • All-Optical Electrophysiology:

    • Engineered variants of Arch-2 with enhanced fluorescence properties could serve as genetically encoded voltage indicators.

    • By analogy with Arch-3, where mutations like D95E/T99C/P196S/T215A created variants with quantum yields up to 0.97% and red-shifted absorption (λmax = 638 nm) , similar engineering of Arch-2 could yield effective voltage sensors.

    • These sensors could enable simultaneous optical recording and manipulation of neural activity, particularly valuable for studying large neural populations.

  • Subcellular Targeting:

    • By adding appropriate targeting sequences, Arch-2 can be directed to specific subcellular compartments (dendrites, axon terminals, soma).

    • This enables studies of compartment-specific contributions to neural signaling and information processing.

  • Minimally Invasive In Vivo Applications:

    • If engineered for red-shifted activation (similar to the 640 nm absorption achieved with certain Arch-3 mutants ), Arch-2 variants could allow deeper tissue penetration for in vivo applications.

    • This would facilitate studies in intact, behaving animals with reduced photodamage and improved spatial precision.

The development of these applications requires systematic characterization and optimization of Arch-2 properties, potentially guided by the successful engineering strategies already demonstrated for related archaerhodopsins.

How can Archaerhodopsin-2 be adapted for voltage sensing applications?

Adapting Archaerhodopsin-2 for voltage sensing applications requires strategic engineering inspired by successful approaches with related proteins like Archaerhodopsin-3:

  • Fluorescence Enhancement Strategy:

    • Introduce mutations that increase the fluorescence quantum yield of Arch-2.

    • Based on Arch-3 research, mutations that stabilize the O-state conformation significantly enhance fluorescence properties .

    • Target residues that influence the protonation state of the Schiff base counterion, as the O-state is associated with a deprotonated Schiff base and protonated counterion .

  • Voltage Sensitivity Optimization:

    • Engineer variants with pKa values of the protonated Schiff base (PSB) in the physiological range (pH 7.2-7.4).

    • For Arch-3, variants with pKa(PSB) around 7.5 showed high voltage sensitivity .

    • Test multiple combinations of mutations to identify those that provide optimal balance between brightness and voltage sensitivity.

  • Spectral Tuning for Imaging Applications:

    • Create red-shifted variants to minimize phototoxicity and enhance tissue penetration.

    • In Arch-3, mutations like D95E/T99C/T215A/A225M achieved absorption maxima of 640 nm .

    • The red shift allows for excitation with longer wavelength light, reducing photodamage and improving compatibility with other optical tools.

  • Kinetic Optimization:

    • Modify the photocycle kinetics to ensure rapid response to voltage changes.

    • For voltage indicators, faster photocycle kinetics generally improve temporal resolution.

  • Membrane Trafficking Enhancement:

    • Add trafficking signals or fusion partners that improve surface expression in mammalian cells.

    • Higher membrane expression increases signal-to-noise ratio for voltage imaging.

  • Experimental Validation Protocol:

    • Characterize voltage sensitivity using patch-clamp electrophysiology combined with fluorescence imaging.

    • Measure the relative change in fluorescence intensity (ΔF/F) in response to defined voltage steps.

    • For Arch-3-based voltage indicators, values of ΔF/F per 100 mV exceeding 85% have been reported .

    • Test speed and linearity of the voltage response across physiologically relevant ranges.

The table below summarizes key mutations that could be adapted from Arch-3 to Arch-2 for creating effective voltage sensors:

Mutation in Arch-3FunctionPotential equivalent in Arch-2Expected outcome
D95ECounterion modificationEquivalent Asp residueRed-shifted absorption
T99CRetinal pocket tuningEquivalent Thr residueEnhanced fluorescence
P196SConformation stabilizationEquivalent Pro residueIncreased quantum yield
T215AHelix stabilizationEquivalent Thr residueFurther enhanced fluorescence
A225MSpectral tuningEquivalent Ala residueRed-shifted absorption

Initial characterization should prioritize measurements of ΔF/F in response to voltage changes, quantum yield, and kinetic properties to identify the most promising variants for further optimization and application.

What are common challenges in working with recombinant Archaerhodopsin-2 and how can they be overcome?

Working with recombinant Archaerhodopsin-2 presents several challenges that researchers should anticipate and address:

  • Low Expression Yields:

    • Challenge: As a membrane protein from an archaeal source, Arch-2 may express poorly in heterologous systems.

    • Solution: Optimize expression using specialized E. coli strains designed for membrane proteins (C41/C43), lower induction temperatures (16-25°C), and longer expression times. Consider codon optimization for the expression host and using stronger promoters or archaeal expression systems for improved yields.

  • Improper Chromophore Incorporation:

    • Challenge: Incomplete retinal incorporation leads to non-functional protein.

    • Solution: Supplement expression media with all-trans-retinal (5-10 μM), add retinal during cell lysis, and protect from light during purification. Verify chromophore incorporation spectroscopically by measuring the ratio of protein absorbance (280 nm) to retinal absorbance (550-570 nm).

  • Protein Misfolding and Aggregation:

    • Challenge: Membrane proteins are prone to misfolding and aggregation during expression and purification.

    • Solution: Use mild detergents for solubilization (DDM, DM, or CHAPS), include stabilizing agents like glycerol (10-20%) in buffers, and purify at 4°C. Consider adding specific lipids that promote proper folding during purification.

  • Detergent-Induced Functional Alterations:

    • Challenge: Detergents can affect protein structure and function compared to the native membrane environment.

    • Solution: Screen multiple detergents and compare functional properties. For definitive functional studies, reconstitute into lipid nanodiscs or liposomes that better mimic the native membrane environment.

  • Limited Stability:

    • Challenge: Purified Arch-2 may show reduced stability over time.

    • Solution: Store at -80°C in buffer containing glycerol (20-30%) and appropriate detergent. For longer-term storage, consider lyophilization in the presence of stabilizers or storage as membrane fragments rather than detergent-solubilized protein.

  • Spectroscopic Interference:

    • Challenge: Cellular pigments or buffer components may interfere with spectroscopic measurements.

    • Solution: Include additional purification steps to remove contaminating pigments. For halobacterial rhodopsins, separate bacterioruberin (a common carotenoid) using high-resolution chromatography methods .

  • Functional Verification:

    • Challenge: Confirming that purified protein retains native activity can be difficult.

    • Solution: Implement multiple functional assays, including spectroscopic measurements of the photocycle and direct measurements of proton-pumping activity in reconstituted systems.

By anticipating these challenges and implementing appropriate solutions, researchers can significantly improve their success in working with recombinant Archaerhodopsin-2.

How can researchers distinguish between properly folded and misfolded Archaerhodopsin-2?

Distinguishing between properly folded and misfolded Archaerhodopsin-2 is crucial for ensuring reliable experimental results. Several complementary approaches can be used:

  • Absorption Spectroscopy Analysis:

    • Properly Folded: Exhibits a characteristic absorption spectrum with a distinct peak in the visible range (typically 550-570 nm for archaerhodopsins) and appropriate absorbance ratio between protein (280 nm) and retinal peaks.

    • Misfolded: Shows reduced or absent retinal absorption peak, shifted spectral features, or abnormal peak shapes.

    • Method: Record full UV-visible spectrum (250-700 nm) and compare with reference spectra. Calculate the ratio of A280/Amax-retinal as a quality metric.

  • Chromophore Binding Assessment:

    • Properly Folded: Efficiently binds all-trans-retinal, forming a covalent Schiff base linkage that remains stable in the dark.

    • Misfolded: Shows poor retinal binding, rapid chromophore release, or abnormal spectral shifts upon retinal addition.

    • Method: Monitor spectral changes upon addition of excess retinal to purified protein. Properly folded protein should show minimal additional chromophore incorporation.

  • Photochemical Reactivity Testing:

    • Properly Folded: Undergoes characteristic photochemical reactions upon illumination, including formation of photointermediates with defined spectral properties.

    • Misfolded: Shows abnormal photochemistry, lacks photointermediate formation, or exhibits non-reversible spectral changes.

    • Method: Record light-dark difference spectra and verify the presence of expected photointermediates.

  • Size Exclusion Chromatography (SEC) Profile:

    • Properly Folded: Elutes as a monodisperse peak at the expected elution volume for detergent-solubilized protein.

    • Misfolded: Forms aggregates that elute in the void volume or shows multiple abnormal elution peaks.

    • Method: Perform analytical SEC and compare with well-characterized standards.

  • Thermal Stability Analysis:

    • Properly Folded: Maintains spectral properties over a range of temperatures and shows cooperative unfolding transition.

    • Misfolded: Exhibits irregular thermal behavior with non-cooperative loss of spectral features.

    • Method: Record absorption spectra at increasing temperatures and analyze the thermal denaturation curve.

  • Functional Activity Verification:

    • Properly Folded: Demonstrates light-driven proton pumping activity when reconstituted into liposomes.

    • Misfolded: Shows reduced or absent proton pumping activity.

    • Method: Measure light-induced pH changes in liposome suspensions using pH-sensitive dyes or electrodes.

These assessments should be performed as a standard quality control workflow during purification and before proceeding to more complex experiments with Archaerhodopsin-2.

What are the best practices for long-term storage of recombinant Archaerhodopsin-2?

Ensuring proper long-term storage of recombinant Archaerhodopsin-2 is essential for maintaining its structural integrity and functional properties. Based on protocols for related membrane proteins, the following best practices are recommended:

  • Buffer Optimization:

    • Use a stabilizing buffer containing 20-50 mM buffer component (Tris, HEPES, or phosphate) at pH 6.5-7.5.

    • Include 100-200 mM NaCl to maintain ionic strength.

    • Add glycerol (20-30%) as a cryoprotectant to prevent ice crystal formation during freezing.

    • Maintain appropriate detergent concentration (typically at 2-3× the critical micelle concentration) to prevent protein aggregation.

    • Consider adding reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) if the protein contains critical cysteine residues.

  • Storage Temperature Selection:

    • For short-term storage (1-2 weeks): 4°C with protection from light.

    • For medium-term storage (1-6 months): -20°C in buffer containing 30% glycerol.

    • For long-term storage (>6 months): -80°C in aliquots to avoid repeated freeze-thaw cycles.

    • Liquid nitrogen storage (-196°C) provides the best long-term stability but requires specialized equipment.

  • Light Protection Strategy:

    • Store all samples in amber or foil-wrapped containers to prevent photobleaching.

    • Minimize exposure to light during handling, as continuous illumination can drive the photocycle and potentially lead to protein degradation.

  • Alternative Storage Forms:

    • Lyophilization: For very long-term storage, lyophilization (freeze-drying) in the presence of appropriate lyoprotectants (sucrose, trehalose) can be effective.

    • Membrane Fragments: For some applications, storing the protein in native-like membrane fragments rather than in detergent solution may better preserve functionality.

    • Immobilized Protein: Immobilization on solid supports with appropriate chemistry can enhance stability for certain applications.

  • Quality Control Protocol:

    • Before storage, verify protein quality using absorption spectroscopy and functional assays.

    • After storage, always perform quality checks before proceeding with experiments.

    • Establish a standard recovery protocol for thawed samples, including centrifugation to remove any aggregates formed during storage.

    • Document storage conditions, duration, and post-storage quality metrics to establish optimal conditions for your specific construct.

  • Reconstitution Considerations:

    • For functional studies after long-term storage, reconstitution into lipid nanodiscs or liposomes may help recover native-like activity.

    • Optimize lipid composition based on the natural membrane environment of halophilic archaea.

By implementing these storage practices, researchers can significantly extend the usable lifetime of purified Archaerhodopsin-2 samples and ensure consistent results across experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.