Recombinant Halobacterium sp. Bacteriorhodopsin (bop)

Shipped with Ice Packs
In Stock

Description

Definition and Significance

Recombinant bacteriorhodopsin refers to the protein produced through heterologous expression systems, such as Escherichia coli or modified Halobacterium strains. Unlike the native protein synthesized in Halobacterium salinarum, recombinant Bop is engineered with tags (e.g., His-SUMO, Myc) for purification and detection . This approach allows researchers to study its proton-pumping mechanism, structural dynamics, and potential applications in bioenergy and optogenetics .

E. coli Expression

  • Product Example: A recombinant fragment (residues 149–166) fused with N-terminal His-SUMO and C-terminal Myc tags is produced in E. coli, yielding >85% purity .

  • Specifications:

    PropertyDetail
    Molecular weight18.0 kDa
    Storage-80°C in Tris/PBS buffer with glycerol or trehalose
    ApplicationsEpigenetics, membrane protein studies

Halobacterium Expression

  • Plasmid-based systems (e.g., pGRB1-derived vectors) restore bacteriorhodopsin function in bop⁻ mutants, though expression levels reach only 25–40% of wild-type due to plasmid instability .

  • Gene replacement techniques enable stable integration of mutant bop genes into the chromosome, facilitating functional studies .

Functional Properties

  • Proton-Pumping Activity: Recombinant Bop retains light-dependent proton translocation when reconstituted into lipid vesicles, matching wild-type kinetics .

  • Photocycle: The retinal chromophore undergoes isomerization (all-trans → 13-cis) upon photon absorption, driving conformational changes that translocate protons .

Regulatory Mechanisms

  • The zinc finger protein Brz, encoded upstream of bop, enhances bop mRNA levels. Deletion of brz reduces transcription by >50% .

  • Insertions in the bop upstream region or coding sequence disrupt expression, suggesting complex transcriptional regulation .

Research Applications

  • Proton Translocation Mutants: Recombinant Bop variants (e.g., Asp96 mutants) exhibit reduced proton-pumping activity, confirming residue-specific roles .

  • Metabolic Engineering: bop deletion increases bacterioruberin biosynthesis (a carotenoid pathway), highlighting competition for retinal precursors .

Challenges in Production

  • Low Yield: Plasmid instability in Halobacterium limits recombinant Bop output .

  • Structural Integrity: While recombinant Bop forms hexagonal lattices akin to native purple membrane, achieving full post-translational modification fidelity remains challenging .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
bop; Bacteriorhodopsin; BR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Haloterrigena sp. (strain arg-4)
Target Names
bop
Target Protein Sequence
MCCAALAPPMAATVGPESIWLWIGTIGMTLGTLYFVGRGRGVRDRKMQEFYIITIFITTI AAAMYFAMATGFGVTEVMVGDEALTIYWARYADWLFTTPLLLLDLSLLAGANRNTIATLI GLDVFMIGTGAIAALSSTPGTRIAWWAISTGALLALLYVLVGTLSENARNRAPEVASLFG RLRNLVIALWFLYPVVWILGTEGTFGILPLYWETAAFMVLDLSAKVGFGVILLQSRSVLE RVATPTAAPT
Uniprot No.

Target Background

Function
Light-driven proton pump.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is bacteriorhodopsin and what is its function in Halobacterium sp.?

Bacteriorhodopsin (BR) is a light-driven proton pump found in the cell membrane of halophilic archaea, particularly in Halobacterium species. It functions by transporting protons across the cell membrane in response to light stimulation, generating an electrochemical gradient that the cell uses for ATP synthesis. The protein consists of 250 amino acids arranged in seven transmembrane helices with a retinal chromophore covalently linked via a protonated Schiff base. Under micro-oxic conditions accompanied by light exposure, the bacterio-opsin activator protein (Bat) binds to upstream activator sequences of the bR regulon, inducing transcription of the bacterio-opsin gene (bop) and associated genes involved in retinal biosynthesis . This light-harvesting mechanism allows Halobacterium to survive in high-salt, low-oxygen environments where oxidative phosphorylation may be limited.

What is the genomic organization of the bacteriorhodopsin gene?

The bacterio-opsin (bop) gene in Halobacterium halobium (now known as H. salinarum) has been cloned with approximately 40 kilobases of flanking genomic sequence. The gene is located in the G+C-rich fraction of the chromosome and is not homologous to major or minor endogenous covalently closed circular DNA species of H. halobium . In the genome of Halobacterium sp. NRC-1, the bop gene is adjacent to genes important for its function and expression, collectively forming the bacteriorhodopsin (bR) regulon . These genes include:

  • bat - bacterio-opsin activator protein gene

  • brp - bacterio-opsin related protein gene

  • crtB1 - phytoene synthase gene (involved in retinal biosynthesis)

  • blp - bacterio-opsin linked protein gene

This genomic organization suggests that the bop mRNA might be processed from a larger mRNA transcript, supported by the fact that the bop mRNA has a 5' leader sequence of only three ribonucleotides . Similar gene linkage patterns have been observed in other haloarchaea like H. marismortui and H. walsbyi, indicating evolutionary conservation of this functional unit .

How is bacteriorhodopsin distributed among different haloarchaeal species?

Bacteriorhodopsin exhibits a patchy distribution pattern among haloarchaeal species, suggesting a complex evolutionary history involving both lateral gene transfer (LGT) and gene loss . Studies mapping the presence/absence of rhodopsins onto phylogenetic markers like RNA polymerase B' subunit (RpoB') have shown that BR is not confined to any specific clade within haloarchaea.

The presence of BR has been confirmed in multiple genera including:

  • Halobacterium sp.

  • Haloarcula marismortui (which possesses two BR genes)

  • Halorhabdus utahensis

  • Natronorubrum sp.

  • Halosimplex carlsbadense

  • Haloterrigena sp.

What expression systems are available for recombinant bacteriorhodopsin production?

Several expression systems have been developed for recombinant bacteriorhodopsin production, each with distinct advantages and limitations:

When selecting an expression system, researchers should consider whether authentic in vivo folding is critical for their application, as heterologous expression in E. coli or yeast may raise questions about possible differences between in vivo and in vitro folding mechanisms .

What methodologies are most effective for site-directed mutagenesis of bacteriorhodopsin?

Site-directed mutagenesis of bacteriorhodopsin provides a powerful tool for studying structure-function relationships in this protein. Based on the current literature, the most effective methodologies include:

  • Plasmid-based mutagenesis in homologous systems: The transformation system using a halobacterial plasmid vector allows for the reintroduction of mutated bop genes into BR-negative strains of Halobacterium. This method permits in vivo folding and expression of the mutant proteins in their native environment .

  • PCR-based mutagenesis coupled with E. coli expression: For BRs that express well in E. coli (such as HmBRI), standard PCR-based site-directed mutagenesis can be performed on the expression vector, followed by expression in E. coli. This approach is particularly useful for rapid screening of multiple mutations .

  • Two-step assembly method: When introducing mutations at critical functional residues (such as Asp85), a two-step approach may be used:

    • Gene engineering to replace the target amino acid

    • Assembly of the recombinant protein into lipid vesicles (e.g., soybean vesicles) followed by retinylation to form functional BR-like nano-particles

For targeted mutations, key residues to consider include Asp85, which is critical for proton transport. Mutations D85V and D85S have been shown to significantly alter both the proton pumping activity and spectroscopic properties of BR, with D85S almost completely abrogating proton translocation while causing a 41 nm red shift in absorption maximum .

How can researchers optimize the functional reconstitution of recombinant bacteriorhodopsin?

Optimizing the functional reconstitution of recombinant bacteriorhodopsin is critical for both structural studies and applications. Based on the literature, the following methodological approach is recommended:

  • Protein purification optimization:

    • For His-tagged bacteriorhodopsin (like the recombinant protein described in ), use immobilized metal affinity chromatography (IMAC) under non-denaturing conditions when possible

    • Store the purified protein in appropriate buffer conditions (e.g., Tris/PBS-based buffer, pH 8.0 with 6% trehalose) to maintain stability

    • Avoid repeated freeze-thaw cycles by storing working aliquots at 4°C for up to one week

  • Reconstitution into lipid environments:

    • Assembly into soybean vesicles has proven effective for recombinant BR mutants

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) before aliquoting for long-term storage at -20°C/-80°C

  • Retinal incorporation:

    • Ensure proper retinylation to form functional BR by incubating the apoprotein with all-trans retinal

    • Monitor the formation of the characteristic purple color, indicating successful chromophore binding

    • Verify functional reconstitution through absorption spectroscopy (wild-type BR has an absorption maximum at approximately 568 nm)

The success of reconstitution can be assessed by measuring both spectroscopic properties and proton pumping activity. Wild-type bacteriorhodopsin should show an absorption maximum around 568 nm, while the D85V and D85S mutants show blue shift (563 nm) and red shift (609 nm), respectively .

What are the current challenges in resolving the phylogenetic history of bacteriorhodopsin genes in haloarchaea?

Resolving the phylogenetic history of bacteriorhodopsin genes in haloarchaea presents several methodological challenges that researchers must address:

  • Incongruence between protein and species phylogenies:
    The bacteriorhodopsin (BR) protein phylogeny shows discrepancies when compared to phylogenetic markers like the RNA polymerase B' subunit (RpoB'). Similarly, halorhodopsin (HR) trees show incongruence with both BR and RpoB' phylogenies . These discrepancies suggest complex evolutionary processes including lateral gene transfer (LGT) and gene loss.

  • Distinguishing between LGT and gene loss:
    The patchy distribution of rhodopsins could result from either frequent gene transfers or ancestral presence followed by multiple independent losses. Researchers should employ multiple lines of evidence:

    • Comparative genomic analyses of bacteriorhodopsin-linked regions across multiple genomes

    • Identification of genomic signatures of LGT (e.g., unusual GC content, codon usage bias)

    • Careful outgroup selection in phylogenetic analyses

  • Partial sampling and detection limitations:
    The inability to amplify BR genes from some genera may represent true absence or methodological limitations. Recommended approaches include:

    • Using multiple primer sets targeting conserved regions

    • Whole genome sequencing rather than PCR-based screening

    • Application of metagenomic approaches to detect rare or divergent BR variants

  • Identifying co-transferred genes:
    Evidence suggests that BR genes are frequently co-transferred with functionally associated genes. The identification of bacterio-opsin associated chaperone (bac) and bacterio-opsin associated protein (bap) as frequently linked to BR genes points to the importance of analyzing genomic context when investigating BR evolution.

To address these challenges, researchers should employ complementary approaches including comparative genomics, robust phylogenetic analyses with appropriate models of sequence evolution, and functional characterization of novel BR variants.

How do bacteriorhodopsin mutants differ in their spectroscopic and proton-pumping properties?

Bacteriorhodopsin mutants exhibit significant variations in both their spectroscopic properties and proton-pumping abilities, providing valuable insights into structure-function relationships. The following methodological analysis summarizes key differences:

  • Spectroscopic Property Variations:

Bacteriorhodopsin VariantAbsorption Maximum (nm)Spectral ShiftReference
Wild-type BR568 nmReference
D85V mutant563 nm5 nm blue shift
D85S mutant609 nm41 nm red shift

The absorption maximum shifts are particularly significant for the D85S mutant, demonstrating how single amino acid substitutions at key positions can dramatically alter the protein's interaction with the retinal chromophore and its electronic properties.

  • Proton Pumping Functional Differences:

Mutations at the critical Asp85 position, which serves as the primary proton acceptor during the BR photocycle, produce dramatic effects on function:

  • D85S mutant: Almost completely abrogates proton translocation, effectively eliminating the proton-pumping function while maintaining photochromic properties

  • D85V mutant: Partially active in pumping protons, showing reduced but not eliminated function

  • Wild-type BR: Full proton-pumping activity

These functional differences correlate with the changes in spectroscopic properties, indicating that the proton translocation mechanism is tightly coupled to the photochemical reactions within the protein.

  • Methodological Approach to Characterizing BR Mutants:

To properly characterize BR mutants, researchers should:

  • Generate the mutations using site-directed mutagenesis

  • Express the mutant proteins (either in native Halobacterium systems or E. coli)

  • Reconstitute the purified proteins into appropriate lipid environments (e.g., soybean vesicles)

  • Measure both absorption spectra and proton-pumping activity

  • Compare the kinetics of the photocycle using time-resolved spectroscopy

The differences in spectroscopic and functional properties make BR mutants valuable for developing various membrane bioreactors (MBr) and unique photo/electro-chromic materials .

What genomic elements regulate bacteriorhodopsin expression in haloarchaea?

The regulation of bacteriorhodopsin expression in haloarchaea involves several genomic elements and environmental factors. The current understanding of this regulatory system includes:

  • Transcriptional Regulation:

    • The bacterio-opsin activator protein (Bat) serves as the primary transcriptional regulator, binding to upstream activator sequences of genes in the BR regulon under micro-oxic conditions with light exposure

    • Bat induces transcription of several genes including:

      • The bat gene itself (autoregulation)

      • Bacterio-opsin (bop)

      • Bacterio-opsin related protein (brp)

      • Phytoene synthase (crtB1)

      • Bacterio-opsin linked protein (blp)

  • Genomic Organization and Possible Operon Structure:

    • Studies of bacterio-opsin mutants suggest that the bop gene may be part of a coordinately expressed operon

    • Multiple mutants show insertions in regions upstream of the bop gene (up to 1,400 base pairs upstream), affecting expression

    • The positions of inserts were localized to four regions:

      • Within the bop gene (one mutant)

      • Overlapping the 5' end of the gene (seven mutants)

      • Two different upstream regions (three mutants)

    • The short 5' leader sequence (three ribonucleotides) of the bop mRNA suggests it might be processed from a larger transcript

  • Conserved Regulatory Elements Across Species:

    • Similar gene linkage patterns have been observed in multiple haloarchaeal genomes, including Halobacterium sp. NRC-1, H. marismortui, and H. walsbyi

    • Even the Cl⁻-pumping halorhodopsin (HR) in Natronomonas pharaonis shows similar genomic context, suggesting convergent evolution of regulatory mechanisms

  • Insertion Elements and Regulation:

    • The high frequency of insertions affecting bop expression (11 out of 12 mutants examined) suggests that mobile genetic elements may play a role in regulating BR expression in natural populations

    • Inserts ranging from 350 to 3,000 base pairs have been observed, with positions correlating to regulatory effects

To study these regulatory elements, researchers should consider comparative genomics approaches across multiple haloarchaeal species, transcriptional analyses under varying environmental conditions, and the construction of reporter gene fusions to identify minimal regulatory regions.

What protocols are most effective for isolating native bacteriorhodopsin from haloarchaeal cultures?

Isolating native bacteriorhodopsin from haloarchaeal cultures requires specialized approaches due to the extreme halophilic nature of these organisms. Based on the search results and established methodologies, the following protocol is recommended:

  • Culture conditions optimization:

    • Grow haloarchaeal cultures in media containing 3.4-4.3M NaCl

    • Maintain illumination to induce BR production (typically with white or red light)

    • Culture under low oxygen conditions to maximize BR expression

    • Monitor culture growth to late exponential or early stationary phase for optimal yields

  • Screening for BR-producing isolates:

    • PCR-based screening can confirm the presence of bacterio-opsin (bop) gene in haloarchaeal isolates, as demonstrated with isolates like wsp3, wsp5, and Haloarcula sp. K1 T from Indian solar salterns

    • Look for characteristic purple coloration in cell pellets, indicating BR production

    • Conduct preliminary spectroscopic analysis showing absorption maximum around 568 nm

  • Membrane isolation and purification:

    • Harvest cells by centrifugation (typically 8,000-10,000 × g for 20 minutes)

    • Lyse cells in low-salt buffer containing DNase to reduce viscosity

    • Collect membrane fractions by ultracentrifugation (100,000 × g for 1 hour)

    • Separate the purple membrane fraction containing BR using sucrose density gradient centrifugation

  • Protein extraction and purification:

    • Extract BR from purple membrane using mild detergents (e.g., Triton X-100 or octyl glucoside)

    • For further purification, column chromatography methods can be employed:

      • Ion-exchange chromatography

      • Size-exclusion chromatography

    • Assess purity by SDS-PAGE and spectroscopic analysis

This isolation protocol can be adapted for different haloarchaeal species, though optimization may be required for species-specific characteristics. The choice between whole-protein isolation and recombinant expression should be guided by the specific research questions and the availability of suitable expression systems for the BR variant of interest.

How can one troubleshoot expression problems with recombinant bacteriorhodopsin in E. coli?

Troubleshooting expression problems with recombinant bacteriorhodopsin in E. coli requires a systematic approach to address the unique challenges associated with this membrane protein. Based on the research literature, the following methodological framework is recommended:

  • Identify common expression obstacles:

    • Poor expression is a frequent challenge with many bacteriorhodopsins in E. coli

    • Attempts to refold BR using published protocols often fail to yield soluble functional protein

    • Membrane proteins like BR may cause toxicity to E. coli cells

  • Optimization strategies:

    a. Expression vector selection:

    • Test multiple E. coli expression vectors with different promoter strengths

    • Consider vectors with tight regulation to control potentially toxic expression

    b. Fusion tag approaches:

    • Utilize N-terminal His-tags as demonstrated with the Halobacterium sp. BR (1-250aa) expressed in E. coli

    • Explore other solubility-enhancing fusion partners (MBP, SUMO, etc.)

    • HmBRI (Haloarcula marismortui bacteriorhodopsin-1) expresses well in E. coli without fusion tags despite sharing only 52% sequence identity with H. salinarum BR

    c. Host strain selection:

    • Test multiple E. coli expression hosts optimized for membrane proteins

    • Consider strains with additional tRNAs for rare codons found in halophilic organisms

    • Evaluate C41(DE3) and C43(DE3) strains specifically designed for membrane protein expression

    d. Expression conditions:

    • Lower temperature (16-20°C) often improves membrane protein folding

    • Reduce inducer concentration to slow expression rate

    • Include chemical chaperones in growth media (e.g., glycerol, specific lipids)

  • Refolding approaches:

    • If inclusion bodies form, develop a customized refolding protocol:

      • Solubilize inclusion bodies in denaturing conditions

      • Gradually remove denaturant by dialysis in the presence of appropriate detergents

      • Add all-trans retinal during refolding to assist proper chromophore binding

    • Monitor refolding success by spectroscopic analysis (absorption at ~568 nm indicates proper folding)

  • Alternative expression systems to consider:

    • If E. coli expression consistently fails, consider returning to homologous expression in Halobacterium halobium

    • Evaluate cell-free expression systems with the addition of specific lipids or nanodiscs

The success of recombinant BR expression varies significantly between different BR variants. If expression problems persist after systematic optimization, researchers may need to explore alternative BR proteins with better expression characteristics, such as HmBRI, or return to native isolation methods.

What analytical techniques are most informative for characterizing bacteriorhodopsin structure and function?

A comprehensive characterization of bacteriorhodopsin structure and function requires multiple complementary analytical techniques. The following methodological approach provides the most informative results:

  • Spectroscopic Analysis:

    a. UV-Visible Absorption Spectroscopy:

    • Measure absorption spectra to determine the λmax (typically ~568 nm for wild-type BR)

    • Monitor spectral shifts in mutants (e.g., D85V shows 5 nm blue shift; D85S shows 41 nm red shift)

    • Use time-resolved spectroscopy to study the BR photocycle kinetics

    b. Circular Dichroism (CD) Spectroscopy:

    • Assess secondary structure composition (the seven transmembrane α-helical structure)

    • Compare structural integrity between wild-type and mutant proteins

    c. Fourier Transform Infrared (FTIR) Spectroscopy:

    • Study hydrogen bonding networks and protonation states

    • Detect conformational changes during the photocycle

    • Particularly valuable for understanding proton transfer mechanisms

  • Structural Characterization:

    a. X-ray Crystallography:

    • Determine high-resolution 3D structure

    • Identify key residues involved in proton transport and retinal binding

    b. Cryo-Electron Microscopy:

    • Study BR in lipid environments closer to native conditions

    • Visualize structural changes in different functional states

    c. NMR Spectroscopy:

    • Analyze protein dynamics and conformational changes

    • Study specific residue interactions through selective labeling

  • Functional Assays:

    a. Proton Pumping Measurements:

    • Measure light-induced pH changes in reconstituted systems

    • Compare pumping efficiencies between wild-type and mutants (e.g., D85V shows partial activity while D85S shows almost no proton translocation)

    b. Patch Clamp Electrophysiology:

    • Directly measure photocurrents in membrane systems

    • Determine voltage-dependence of proton transport

    c. Reconstitution into Model Membranes:

    • Assemble BR into soybean vesicles or other lipid systems

    • Create functional BR-like nano-particles for transport studies

  • Molecular Analysis:

    a. Site-Directed Mutagenesis:

    • Target key functional residues like Asp85

    • Map structure-function relationships systematically

    b. Sequence Analysis and Comparison:

    • Compare BR sequences across different haloarchaeal species

    • Identify conserved residues and specialized adaptations

For any significant structural or functional study of bacteriorhodopsin, researchers should employ multiple techniques from this list to develop a comprehensive understanding of the protein. The specific combination should be tailored to the research question, with spectroscopic analysis and functional assays forming the core of any BR characterization workflow.

What are the most promising applications of recombinant bacteriorhodopsin variants in scientific research?

Recombinant bacteriorhodopsin variants offer numerous innovative applications in scientific research. Based on the current literature, the following areas show particular promise:

  • Biophysical Research Tools:

    • Modified bacteriorhodopsins with altered spectroscopic properties (such as the D85S variant with red-shifted absorption) provide valuable tools for studying photochemical reactions and energy transduction mechanisms

    • The varying proton transport capabilities of different mutants enable detailed investigation of ion transport mechanisms across membranes

  • Membrane Protein Folding Studies:

    • The availability of both in vivo and in vitro folding systems for bacteriorhodopsin makes it an excellent model system for studying membrane protein folding and stability

    • Comparative analysis between folding in native Halobacterium systems versus heterologous expression can reveal fundamental principles applicable to other membrane proteins

  • Optogenetic Applications:

    • Bacteriorhodopsin variants with specific photochemical properties can be engineered for optogenetic tools

    • The natural light-activated proton pumping function provides a foundation for developing novel neural modulators

  • Bioelectronic Interfaces:

    • BR mutants with different spectroscopic activities can be utilized to produce unique photo/electro-chromic materials and tools

    • The development of membrane bioreactors (MBr) incorporating BR variants offers potential for light-sensitive bioelectronic devices

  • Evolutionary Studies:

    • The complex evolutionary history of bacteriorhodopsin genes in haloarchaea provides a model system for studying lateral gene transfer and adaptation

    • Comparative analysis of BR variants across species can reveal evolutionary patterns in extremophile adaptations

  • Nano-biotechnology Platforms:

    • BR-like nano-particles formed by assembling recombinant proteins into lipid vesicles can serve as building blocks for nanoscale devices

    • The natural 2D crystalline arrangement of BR in purple membrane provides templates for ordered nanomaterial design

The successful expression of bacteriorhodopsin in E. coli systems has significantly expanded access to this protein for research applications, overcoming previous limitations in availability and enabling more widespread incorporation into various experimental platforms.

How might novel bacteriorhodopsin variants be designed to enhance specific research applications?

Designing novel bacteriorhodopsin variants with enhanced properties for specific research applications requires a methodical approach combining protein engineering principles with detailed understanding of BR structure-function relationships. Based on the current research, the following strategies are recommended:

  • Spectral Tuning for Optical Applications:

    • Target the retinal binding pocket: Mutations like D85S produce significant red shifts (41 nm) that can be exploited for spectral diversity

    • Combine multiple mutations to achieve specific absorption characteristics

    • Design variants with non-overlapping absorption spectra for multiplexed applications

    • Methodological approach: Create a combinatorial library of mutations around the chromophore and screen for desired spectral properties

  • Enhanced Stability for Biotechnological Applications:

    • Improve thermostability through the introduction of additional hydrogen bonds or salt bridges

    • Increase tolerance to non-native detergents and lipid environments

    • Enhance pH stability range through modification of titratable residues

    • Methodological approach: Use computational design to identify stabilizing mutations, then validate experimentally

  • Optimized Expression Systems:

    • Engineer BR variants that express more efficiently in E. coli, building upon successes like HmBRI

    • Design chimeric proteins combining well-expressed regions from different BR variants

    • Create fusion constructs that enhance folding while maintaining function

    • Methodological approach: Conduct comparative sequence analysis between well-expressed BRs (like HmBRI) and poorly expressed variants to identify critical regions

  • Functional Modifications:

    • Engineer the proton translocation pathway to create variants with altered ion specificity or transport rates

    • Develop BR variants with modified photocycle kinetics (faster or slower) for specific applications

    • Create light-gated channels rather than pumps through strategic mutations

    • Methodological approach: Focus mutations on key residues in the proton pathway, particularly D85, D96, and R82

  • Sensor Development:

    • Design BR variants that change their spectral properties in response to specific environmental parameters (pH, ion concentration, membrane potential)

    • Create BR fusion proteins that couple conformational changes to reporter functions

    • Methodological approach: Introduce environmentally sensitive residues at strategic positions in the protein structure

These design strategies can be implemented through standard molecular biology techniques including site-directed mutagenesis, followed by expression in appropriate systems (E. coli or native Halobacterium hosts) and comprehensive characterization using the analytical techniques outlined in section 3.3. The D85V and D85S mutants demonstrate how single amino acid substitutions can dramatically alter both functional and spectroscopic properties , providing a foundation for more sophisticated protein engineering approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.