Recombinant Halobacterium sp. Sensory rhodopsin-1 (sop1)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

SR-1 mediates phototaxis by detecting light intensity and wavelength, triggering conformational changes that interact with transducer proteins (e.g., HtrI).

Photocycle and Signal Transduction

  • Light Activation: Absorption of blue-green light (560 nm) induces retinal isomerization (all-trans → 13-cis), initiating a photocycle .

  • Proton Transfer: His-166 facilitates proton movement during the photocycle, distinct from bacteriorhodopsin’s proton-pumping mechanism .

  • Transducer Interaction: Conformational changes propagate to HtrI, modulating flagellar motor activity for positive/negative phototaxis .

Key Differences from Bacteriorhodopsin

FeatureSR-1Bacteriorhodopsin
FunctionPhototaxis signalingProton pumping
Photocycle SpeedSlower (seconds)Faster (milliseconds)
Retinal BindingRequires steric interaction at 13-methylNo steric constraint
CounterionTyr-87 (vs Asp-96 in BR) Asp-96

Production and Purification

Recombinant sop1 is heterologously expressed in E. coli and purified via affinity chromatography.

ParameterValueSource
Expression HostE. coli
Purification MethodNi-NTA agarose (His-tag)
Purity>98% (SDS-PAGE)
Buffer4 M NaCl, 50 mM MES pH 6.0, 0.03% DDM
StabilityRequires high salt concentrations

Quality Control
Activity is verified via UV-Vis spectroscopy:

  • A280/A590 Ratio: 1.7 (indicative of retinal binding) .

  • Extinction Coefficient (560 nm): 63,000 M⁻¹ cm⁻¹ .

Biochemical and Biophysical Studies

  • Crystallization: Used as a control for membrane protein crystallization due to its stability .

  • Mutagenesis: Synthetic sop1 genes with 30 restriction sites enable site-directed mutagenesis .

  • Spectroscopy: Flash-induced absorption difference spectra confirm photocycle kinetics .

Functional Restoration

Deletion mutants lacking SR-1 regain phototaxis when transformed with recombinant sop1, validating its functional fidelity .

Homologous Proteins

Eubacterial homologs (e.g., Salinibacter ruber SR-I) share ~40% identity but lack Tyr-163, suggesting divergent evolutionary pathways .

Key Research Findings

  1. Structural Insights:

    • SR-1’s tertiary structure mirrors bacteriorhodopsin, with conserved residues stabilizing retinal .

    • Tyr-87 replaces Asp-96 (BR’s proton acceptor), slowing the photocycle .

  2. Activation Mechanism:

    • Steric hindrance between retinal’s 13-methyl group and protein residue is critical for SR-1 activation .

    • This mechanism parallels mammalian rhodopsin signaling, highlighting conserved principles .

  3. Biotechnological Potential:

    • Engineered sop1 variants enable studies on light-driven signaling and ion transport .

    • Recombinant SR-1 aids in understanding retinal-protein interactions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please contact your local distributor.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize the development of your specified tag.
Synonyms
sop1; sopI; Sensory rhodopsin-1; Sensory rhodopsin I; SR-I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Halobacterium sp. (strain SG1)
Target Names
sop1
Target Protein Sequence
MTGAVSAAYWIAAVAFLVGLGITAALYAKLGESEDRGRLAALAVIPGFAGLAYAGMALGI GTVTVNGAELVGLRYVDWIVTTPLLVGFIGYVAGASRRAIAGVMLADALMIAFGAGAVVT GGTLKWVLFGVSSIFHVTLFAYLYVVFPRAVPDDPMQRGLFSLLKNHVGLLWLAYPFVWL MGPAGIGFTTGVGAALTYAFLDVLAKVPYVYFFYARRQAFTDVVSAATADREDATDAVGD GAPTAAD
Uniprot No.

Target Background

Function
Sensory rhodopsin-1 (Sop1) plays a crucial role in controlling phototaxis. It mediates both photoattractant responses (in orange light) and photophobic responses (in near UV light). The signal is subsequently transmitted to the sensory rhodopsin I transducer (HTR-I).
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sensory rhodopsin-1 and what is its primary function in Halobacterium species?

Sensory rhodopsin-1 (SR-I) is a 7-transmembrane photoreceptor protein that functions as a phototaxis receptor in archaebacteria, particularly Halobacterium species. SR-I responds primarily to red light stimuli and mediates positive phototaxis, allowing the organism to move toward favorable light conditions. The protein contains a covalently bound all-trans retinal chromophore attached to a lysine residue, which undergoes photoisomerization upon light absorption, triggering conformational changes that initiate the signaling cascade. SR-I works in conjunction with its cognate transducer protein to transmit light signals to the flagellar motor, enabling the organism to navigate based on light cues . This photosensing system represents one of the simplest known light signal transduction mechanisms and serves as a model for understanding more complex photoreceptor systems.

What is the genetic basis for SR-I expression and how has the gene been optimized for research purposes?

The gene encoding Sensory rhodopsin-I in Halobacterium is known as sopI. For research applications, synthetic sopI genes have been designed with specific optimizations. A notable example is a synthetic sopI gene that was engineered with 30 unique restriction sites distributed uniformly throughout the 720-bp coding region . This design allows for efficient cassette mutagenesis, facilitating structure-function studies. For expression, researchers have successfully placed the sopI coding region downstream of the bacterioopsin gene promoter and translation initiation region on selectable vectors . This construct typically encodes SR-I with an extended N-terminus that includes a 13-amino acid leader sequence and the 8-amino acid N-terminus of bacterioopsin. The synthetic gene products have been shown to be functionally identical to native SR-I, exhibiting characteristic flash-induced absorption difference spectra and photochemical reaction cycles while fully restoring phototaxis responses in deletion strains .

What expression systems are most effective for producing functional recombinant SR-I?

While native SR-I is produced in Halobacterium species, recombinant expression has been successfully achieved in Escherichia coli for research purposes . When expressing SR-I in E. coli, several considerations must be addressed:

  • Codon optimization: The gene sequence should be optimized for E. coli codon usage while maintaining the functional protein structure.

  • Affinity tagging: Addition of affinity tags (commonly histidine tags) facilitates purification. Commercially available recombinant SR-I typically includes a 10× histidine tag at the C-terminus .

  • Membrane integration: As a 7-transmembrane protein, proper folding and membrane insertion are critical for function.

  • Retinal supplementation: The expression medium must be supplemented with all-trans retinal to ensure proper chromophore incorporation.

The expression in heterologous systems like E. coli offers advantages for protein engineering studies but requires careful optimization to maintain the protein's functional properties.

What purification methods yield the highest purity and activity for recombinant SR-I?

The purification of functional recombinant SR-I typically follows this methodological approach:

  • Membrane fraction isolation: After cell lysis, membrane fractions containing the expressed SR-I are isolated through differential centrifugation.

  • Detergent solubilization: Membrane proteins are solubilized using mild detergents such as dodecyl maltoside (DDM) at 0.03% concentration to maintain protein structure and function .

  • Affinity chromatography: His-tagged SR-I can be efficiently purified using Ni-NTA agarose affinity chromatography .

  • Buffer conditions: High salt concentrations (typically 4 M NaCl) in the purification buffers are essential to maintain protein stability, mimicking the halophilic environment of the native organism .

  • Quality assessment: Purified SR-I should be evaluated by UV-Vis spectroscopy, with an optimal absorbance ratio (280/590 nm) of approximately 1.7, indicating proper folding and chromophore binding .

This purification approach consistently yields SR-I with >98% purity suitable for biophysical and functional studies.

What spectroscopic methods can be used to confirm the identity and functionality of purified SR-I?

Several spectroscopic techniques are crucial for characterizing purified SR-I:

UV-Visible Absorption Spectroscopy:

  • SR-I exhibits a characteristic absorption maximum at approximately 560-590 nm due to the bound retinal chromophore

  • The extinction coefficient at 560 nm is 63,000 M⁻¹ cm⁻¹

  • A properly folded protein with correctly bound chromophore shows an absorbance ratio (280 nm/590 nm) of approximately 1.7

  • Tracking spectral shifts during light exposure provides information about the photocycle

Flash Photolysis:

  • Used to characterize the photochemical reaction cycle

  • Measures transient absorption changes following a brief light pulse

  • Provides kinetic information about photocycle intermediates

Circular Dichroism (CD):

  • Evaluates secondary structure composition and proper protein folding

  • Particularly useful for comparing wild-type and mutant proteins

Resonance Raman Spectroscopy:

  • Provides detailed information about the retinal chromophore configuration

  • Can detect subtle changes in the chromophore environment upon photoisomerization

The combination of these techniques provides comprehensive information about protein quality and function for research applications.

What buffer conditions maintain SR-I stability during in vitro experiments?

Maintaining SR-I stability requires careful attention to buffer composition:

Buffer ComponentRecommended ConcentrationPurpose
NaCl4 MMaintains protein stability; mimics native halophilic environment
MES buffer50 mM, pH 6.0Provides optimal pH for protein stability
Dodecyl maltoside (DDM)0.03%Solubilizes membrane protein while preserving structure
Glycerol10% (optional)Provides additional stability for long-term storage

SR-I requires high salt concentrations that reflect its halophilic origin. The protein is most stable at slightly acidic pH (6.0-6.5), and the presence of a mild detergent is essential for maintaining solubility . For long-term storage, samples should be protected from light to prevent photobleaching of the retinal chromophore. When conducting experiments requiring different buffer conditions, it is advisable to perform gradual buffer exchanges to prevent protein denaturation.

How does SR-I interact with its cognate transducer protein, and what methods can be used to study this interaction?

SR-I interacts with its cognate transducer protein (Htr) to initiate signal transduction following photon absorption. This interaction can be studied using several approaches:

  • Co-expression and co-purification: SR-I and its transducer can be co-expressed to form a stable complex. Fusion proteins comprising SR-I and the transducer have been successfully created to ensure proper stoichiometry and interaction .

  • Spectroscopic assays: The interaction between SR-I and its transducer alters the photocycle kinetics, particularly the M-intermediate decay rate. Monitoring these changes provides evidence of functional interaction .

  • Phototaxis assays: Transformation of SR-I-transducer fusion proteins into Halobacterium strains allows observation of phototactic responses. This approach has been used to demonstrate that the SRM-HtrM fusion protein attenuates both positive and negative phototaxis responses mediated by SRI and SRII .

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can identify specific interaction sites between SR-I and its transducer.

  • FRET (Förster Resonance Energy Transfer): By labeling SR-I and its transducer with appropriate fluorophores, FRET measurements can provide real-time information about their interaction dynamics.

These complementary approaches provide comprehensive insights into the molecular mechanisms underlying SR-I signal transduction.

How does SR-I signaling compare to other sensory rhodopsins in Halobacterium species?

Halobacterium species contain multiple sensory rhodopsins with distinct spectral sensitivities and phototactic functions:

Sensory RhodopsinAbsorption MaximumPhototaxis ResponseSignal Transduction
SR-I (SRI)Red light (~560-580 nm)Positive phototaxisInteracts with HtrI transducer
SR-II (SRII)Blue light (~480-490 nm)Negative phototaxisInteracts with HtrII transducer
SRMBlue-green light (~504 nm)Attenuates both positive and negative phototaxisInteracts with HtrM transducer

Notably, while SR-I mediates movement toward red light (positive phototaxis) and SR-II mediates movement away from harmful blue light (negative phototaxis), the blue-green sensing SRM acts as a modulator that attenuates both responses . This creates a sophisticated integrated photosensory system enabling Halobacterium to optimize its position relative to light conditions. The genome of Haloarcula marismortui encodes all three sensory rhodopsins (SRI, SRII, and SRM), suggesting a complex phototaxis system . Research indicates that each sensory rhodopsin interacts with its specific cognate transducer protein to mediate these distinct phototactic responses.

How can site-directed mutagenesis be applied to study SR-I structure-function relationships?

Site-directed mutagenesis is a powerful approach for investigating SR-I structure-function relationships. The development of synthetic sopI genes with multiple unique restriction sites has greatly facilitated these studies . Key methodological considerations include:

  • Cassette mutagenesis: The engineered sopI gene containing 30 unique restriction sites allows for efficient replacement of gene segments with mutated versions .

  • Target selection:

    • Retinal-binding pocket residues can be mutated to alter spectral properties

    • Transducer interaction sites can be modified to study signal transduction

    • Proton transfer pathway residues help elucidate photocycle mechanisms

  • Functional assessment: Mutant proteins should be characterized by:

    • Absorption spectroscopy to evaluate chromophore binding and spectral shifts

    • Flash photolysis to analyze photocycle kinetics

    • Phototaxis assays to assess biological function in vivo

  • Expression systems: For efficient screening, mutants can be expressed in both:

    • E. coli for rapid protein production and in vitro characterization

    • Halobacterium deletion strains (ΔsopI) for in vivo functional assessment

This approach has successfully identified key residues involved in spectral tuning, photocycle kinetics, and transducer interaction, providing molecular insights into SR-I function.

What are the methods for creating and characterizing gene knockout strains for SR-I studies?

Creating SR-I gene knockout strains is essential for functional complementation studies. The methodology involves:

  • Homologous recombination strategy:

    • Design DNA constructs containing selectable markers flanked by regions homologous to sequences upstream and downstream of the sopI gene

    • Transform these constructs into Halobacterium cells

    • Select for recombinants using appropriate markers

  • Verification of gene deletion:

    • PCR analysis using primers flanking the deleted region

    • Southern blot analysis to confirm deletion at the genomic level

    • Western blot using anti-SR-I antibodies to verify absence of protein expression

    • Phenotypic confirmation through loss of specific phototactic responses

  • Complementation studies:

    • Transform deletion strains with vectors containing wild-type or mutant sopI genes

    • Express SR-I with affinity tags (e.g., His-tag) or fused to transducer proteins

    • Assess restoration of phototaxis responses using motion analysis systems

Researchers have successfully used homologous recombination to delete the chromosomal sopI gene in Halobacterium halobium, creating an SR-I deletion strain that shows specific phototaxis defects . This deletion strain provides an excellent background for expressing synthetic or mutant sopI genes to study structure-function relationships.

How can recombinant SR-I be integrated into artificial membrane systems for biophysical studies?

Incorporating recombinant SR-I into artificial membrane systems enables detailed biophysical investigations under controlled conditions. The methodology includes:

  • Proteoliposome preparation:

    • Solubilize purified SR-I in detergent (typically 0.03% DDM)

    • Mix with lipids (commonly E. coli polar lipids or synthetic lipids)

    • Remove detergent through dialysis or adsorption to Bio-Beads

    • Characterize proteoliposomes for protein incorporation and orientation

  • Planar bilayer systems:

    • SR-I can be reconstituted into planar lipid bilayers for electrical measurements

    • This system allows precise control of membrane composition and environmental conditions

  • Solid-supported bilayers:

    • Useful for surface-sensitive techniques such as atomic force microscopy or surface plasmon resonance

    • Enables investigation of protein-protein interactions at the membrane surface

  • Buffer considerations:

    • High salt concentrations (3-4 M NaCl) are typically required to maintain protein stability

    • The pH should be maintained around 6.0-6.5 for optimal stability

These artificial membrane systems enable investigations of SR-I photocycle dynamics, conformational changes, and transducer interactions under precisely controlled conditions that would be impossible in cellular systems.

What advanced spectroscopic techniques provide insights into SR-I photocycle dynamics?

Understanding the SR-I photocycle requires sophisticated spectroscopic approaches:

  • Time-resolved spectroscopy:

    • Ultrafast spectroscopy (femtosecond to picosecond) captures the earliest events following photon absorption

    • Flash photolysis with microsecond to millisecond resolution tracks later intermediates

    • These methods reveal the sequence and lifetime of photocycle intermediates

  • FTIR difference spectroscopy:

    • Identifies specific bond changes during the photocycle

    • Detects protonation/deprotonation events and protein conformational changes

    • When combined with site-directed mutagenesis, can assign spectral changes to specific residues

  • Resonance Raman spectroscopy:

    • Provides detailed information about retinal configuration changes

    • Identifies key vibrational modes associated with photoisomerization

  • Solid-state NMR:

    • Can detect subtle structural changes in labeled proteins

    • Particularly valuable for membrane proteins like SR-I

These advanced spectroscopic techniques have revealed that the SR-I photocycle involves all-trans/13-cis isomerization of retinal, which is required for phototaxis signaling in Halobacterium . The combination of these methods has provided unprecedented insights into the molecular mechanisms of photoreception and signal transduction in this archaeal system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.