Recombinant Haloferax volcanii Glycosyltransferase AglG (aglG)

Shipped with Ice Packs
In Stock

Description

Introduction

Haloferax volcanii is an archaeon known for its unique N-glycosylation pathway, a post-translational modification crucial for protein folding, stability, and function across all life domains . In H. volcanii, the archaeal glycosylation (Agl) pathway involves several glycosyltransferases, including AglG, which plays a vital role in synthesizing and attaching glycans to proteins . Specifically, AglG participates in the N-glycosylation of the S-layer glycoprotein and flagellins, which are essential for cell motility and stability .

AglG Function in N-Glycosylation

AglG is involved in the biosynthesis of hexuronic acids within a pentasaccharide that decorates the S-layer glycoprotein in H. volcanii . Changes in the transcription profile of aglM (a gene associated with AglG) mirror those of aglF, aglG, and aglI, suggesting that N-glycosylation has an adaptive role in H. volcanii . AglG is essential for the proper glycosylation of flagellins, particularly FlgA1, a major flagellin, and FlgA2, a minor flagellin . The glycosylation of flagellins is critical for flagellar stability and, consequently, cell motility .

Role of AglG in Flagellar Glycosylation and Motility

The glycosylation of H. volcanii flagellins requires Agl components involved in S-layer glycosylation . Deletion of agl genes disrupts the Agl glycosylation pathway, leading to unstable flagella . Studies have confirmed that flagellins such as FlgA1 have three N-glycosylation sites modified with pentasaccharides, which have the same mass as those modifying the S-layer glycoprotein . Mutating the asparagine residues at these N-glycosylation sites results in non-motile cells, demonstrating that N-glycosylation of archaeal flagellins is crucial for motility .

AglG and Related Glycosyltransferases

AglC and AglK are also involved in N-glycosylation . These glycosyltransferases participate in the biosynthesis or transfer of diacetylated glucuronic acid within the glycan structure . In Methanococcus voltae, deletion of aglC and aglK interferes with N-glycosylation, resulting in flagellin and S-layer proteins with reduced molecular masses, loss of flagellar assembly, and absence of glycan attachment .

Glycosylation and Pilus Assembly

In H. volcanii, AglB-dependent glycosylation of the S-layer and flagellin FlgA1 results in proteins modified with a pentasaccharide . The absence of AglB leads to the formation of thick bundles containing multiple filaments, and the lack of AglB-dependent glycosylation promotes microcolony formation . N-glycosylation is crucial for the functions of PilA3 and PilA4 pilins but not for the assembly of pili containing PilA4 subunits .

Affinity Tags and Protein Purification in H. volcanii

Affinity tags are used for protein production and purification in H. volcanii . Various tags, such as polyhistidine-tag (His-tag), Strep-tag II, Twin-Strep-tag, FLAG-tag, and 3x-FLAG-tag, are employed at the N- and C-termini of proteins . The use of these affinity tags allows for efficient expression, solubility, and purification estimations of fusion proteins .

7.1. Impact of agl Gene Deletions on Flagellar Glycosylation

Gene DeletionEffect on GlycosylationPhenotype
aglBDisrupts glycosylationUnstable flagella, non-motile cells
aglC, aglKInterferes with glycosylationReduced molecular masses, loss of flagellar assembly

7.2. Glycosylation Mutants and Motility

MutationEffect on Glycosylation SitePhenotype
Asparagine to GlutaminePrevents glycosylationNon-motile cells

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aglG; HVO_1529; Glucosyl-dolichyl phosphate glucuronosyltransferase; Archaeal glycosylation protein G; Glycosyltransferase AglG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)
Target Names
aglG
Target Protein Sequence
MKVSVVVCTYSMERYESFSETVESVLAQTYEPLELVIVVDGNEEEFDRVQDDFGDIDDVV LHCNDENRGISYSRTKGAELGTGDVVAMIDDDATAEPDWIETLVDTYENNPDAVAVGGTV VPDWVARKPEFFPEEFYWLVGCDERGFGEHMEEVRNTYGSNISFKRDVFLEVGGYDTNTG RKGDKHVQAHEAPVCIRIYEQTGERVIYNKQARVNHKLFEYRTEFDWLVFRSFWQGYSKR VMDLLYPQASDDKNAYLKDLMLVYVVDRLKNLVEDPSLAQVQQLIAIFVFTAAVGFGYVY GLLTPNLVEKTNN
Uniprot No.

Target Background

Function
AglG, a glycosyltransferase from *Haloferax volcanii*, participates in N-linked protein glycosylation. It assembles and attaches an N-linked pentasaccharide to S-layer glycoproteins and flagellins. Specifically, AglG catalyzes the transfer of a glucuronate residue (GlcA) to a glucose residue on dolichol phosphate (DolP), an archaeal glycan lipid carrier. While in vitro studies show activity with DolP-Glc containing an unsaturated omega-position isoprene, the physiological substrate is likely alpha,omega-saturated.
Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of AglG in the N-glycosylation pathway of Haloferax volcanii?

AglG functions as a glycosyltransferase within the archaeal glycosylation (Agl) pathway of Haloferax volcanii. It contributes to the synthesis of the pentasaccharide that decorates both S-layer glycoproteins and flagellins. The complete Agl pathway is responsible for the sequential assembly of a pentasaccharide composed of a hexose (glucose), two hexuronic acids (glucuronic acid and galacturonic acid), a methylated hexuronic acid (methyl-O-4-glucuronic acid), and a terminal mannose . AglG is specifically involved in the transfer of one of these sugar moieties during the assembly of this glycan structure.

How does AglG contribute to Haloferax volcanii cellular functions?

The glycosylation mediated by AglG and other Agl components is critical for multiple cellular functions in H. volcanii. Research demonstrates that proper N-glycosylation is essential for flagellar assembly and swimming motility . When glycosylation is disrupted through deletion of components like AglB (the oligosaccharyltransferase), cells lack stable flagella, resulting in motility defects . Additionally, glycosylation affects cell surface properties that facilitate cellular interactions such as mating and adhesion . The modification of surface proteins by AglG therefore has significant implications for the organism's ability to respond to its environment and interact with other cells.

What structural features characterize AglG compared to other glycosyltransferases?

As a glycosyltransferase, AglG contains conserved structural motifs characteristic of this enzyme family but with archaeal-specific adaptations. While the search results don't provide specific structural information about AglG, we can infer from related research that it likely belongs to the broader glycosyltransferase superfamily. These enzymes typically contain nucleotide-binding domains that interact with the sugar donor substrate and acceptor-binding regions that recognize specific target sequences. The enzyme must function in the high-salt cytoplasmic environment of Haloferax volcanii, suggesting structural adaptations that maintain activity under halophilic conditions.

How does environmental salinity affect AglG activity and glycosylation patterns?

Environmental salinity significantly impacts glycosylation patterns in Haloferax volcanii, potentially through effects on AglG and other glycosylation enzymes. Research indicates that H. volcanii cells grown at different salt concentrations demonstrate altered mating efficiencies, which correlates with changes in glycosylation patterns . High salt conditions (3.4M NaCl) appear to promote more efficient mating, suggesting optimal glycosylation activity under these conditions . This environmental sensitivity may reflect evolutionary adaptation of the glycosylation machinery, including AglG, to function optimally in the fluctuating salt concentrations of hypersaline environments. Researchers investigating AglG should consider maintaining consistent salt concentrations during enzyme activity assays to ensure reproducible results.

What are the comparative functional differences between AglG and other Agl pathway glycosyltransferases?

The Agl pathway in H. volcanii contains multiple glycosyltransferases (including AglG) that function sequentially to build the pentasaccharide glycan structure. Each enzyme has specificity for particular sugar donors and acceptor substrates. While the search results don't provide direct comparative data for AglG versus other Agl glycosyltransferases, research on the pathway suggests functional specialization. Deletion studies of various agl genes demonstrate different phenotypic consequences, indicating non-redundant functions . For instance, deletion of aglB (the oligosaccharyltransferase) has profound effects on flagellin glycosylation and motility, while the effects of other glycosyltransferase deletions may be more subtle or substrate-specific . Understanding these functional differences is critical for reconstructing the exact sequence of glycan assembly.

How do site-directed mutations in AglG catalytic domains affect substrate specificity?

Site-directed mutagenesis of AglG catalytic domains can provide insights into substrate recognition and enzymatic mechanism. While specific mutagenesis data for AglG is not available in the search results, related research on glycosyltransferases suggests that mutations in key catalytic residues can alter sugar donor specificity, transfer efficiency, and product formation. Researchers investigating AglG should target conserved motifs involved in nucleotide-sugar binding and catalysis. Comparative analysis with other characterized glycosyltransferases can guide the selection of mutation targets. Enzyme activity assays using various sugar donors following site-directed mutagenesis would reveal the structural basis for AglG's substrate specificity.

What expression systems are optimal for producing functional recombinant AglG?

For functional expression of recombinant Haloferax volcanii AglG, researchers must consider the halophilic nature of this enzyme. Expression systems must account for the potential requirement of high salt for proper folding and activity. While the search results don't provide specific protocols for AglG expression, several approaches can be considered:

  • Homologous expression in H. volcanii: This maintains the native high-salt environment and post-translational modifications but may yield lower protein amounts.

  • Heterologous expression in E. coli with subsequent refolding: This requires addition of salt during purification and refolding steps to obtain active enzyme.

  • Expression in halotolerant yeast systems: These may provide a compromise between yield and native-like folding conditions.

For optimal results, using a vector with an inducible promoter and a C-terminal or N-terminal affinity tag (ensuring it doesn't interfere with catalytic activity) will facilitate purification. Validation of expression should include both activity assays and structural integrity assessment.

How can AglG activity be reliably measured in vitro?

Measuring AglG glycosyltransferase activity in vitro requires appropriate donor substrates, acceptor molecules, and detection methods suitable for halophilic conditions. A recommended assay protocol would include:

  • Donor substrate preparation: Use the appropriate nucleotide-activated sugar (likely UDP- or GDP-linked, based on the target glycan structure).

  • Acceptor preparation: Either synthetic peptides containing the N-glycosylation consensus sequence (Asn-X-Ser/Thr, where X is any amino acid except Pro) or partially glycosylated natural substrates.

  • Reaction conditions: Buffer containing 2-3M KCl or NaCl, pH 7.0-8.0, with appropriate divalent cations (Mg²⁺ or Mn²⁺).

  • Detection methods:

    • Radiochemical assay using labeled sugar donors

    • HPLC or mass spectrometry to detect glycopeptide products

    • Coupled enzymatic assays that detect released nucleotides

Activity should be normalized to enzyme concentration and measured under various salt concentrations to determine optimal conditions.

What strategies enable identification of AglG-specific substrates in vivo?

Identifying the specific substrates modified by AglG in vivo requires targeted genetic and biochemical approaches. Researchers should consider:

  • Gene deletion and complementation: Create an aglG deletion strain, then complement with wild-type or catalytically inactive versions to identify differentially glycosylated proteins.

  • Metabolic labeling: Incorporate modified sugars that can be detected via click chemistry or other bioorthogonal reactions to track newly glycosylated proteins.

  • Mass spectrometry comparison: Compare glycopeptide profiles between wild-type and aglG deletion strains using techniques like HCD and IS-CID, which have successfully identified glycosites in H. volcanii proteins .

  • Substrate trapping: Engineer AglG variants that bind but cannot release substrates, enabling co-purification of enzyme-substrate complexes.

Based on existing H. volcanii research, key target proteins to assess include flagellins FlgA1 and FlgA2, S-layer glycoproteins, and pilins PilA1-6, as these surface proteins are known to be N-glycosylated .

How can contradictory glycosylation pattern data be reconciled across different analytical platforms?

Researchers studying AglG-mediated glycosylation may encounter contradictory data when using different analytical methods. To reconcile such discrepancies:

  • Analytical method validation: Each method has specific biases and limitations. Mass spectrometry may preferentially detect certain glycopeptides, while gel mobility assays may not resolve all glycoforms. Use multiple orthogonal techniques and compare their limitations.

  • Sample preparation effects: Differences in cell growth conditions, protein extraction methods, and glycopeptide enrichment protocols can affect glycan detection. Standardize these procedures across experiments.

  • Integrated data analysis: When contradictions appear, use statistical approaches to weight evidence from multiple methods, considering their known reliability for specific glycan types.

  • Biological variability assessment: Determine whether contradictions reflect genuine biological heterogeneity rather than technical artifacts by examining biological replicates and controls.

Systematic documentation of conditions used for each analytical method is essential for meaningful cross-platform comparisons. When reporting glycosylation patterns, researchers should explicitly state the detection methods used and their known limitations.

What statistical approaches are most appropriate for analyzing AglG substrate specificity?

When analyzing AglG substrate specificity from experimental data, appropriate statistical approaches include:

  • Position weight matrices (PWMs): These capture sequence preferences around glycosylation sites, revealing residues that enhance or diminish AglG activity. Calculate enrichment scores for each amino acid at positions flanking the modified asparagine.

  • Machine learning models: Train models using verified AglG substrates and non-substrates to predict new targets. Random forest or support vector machine algorithms can incorporate both sequence and structural features.

  • Comparative enrichment analysis: When comparing glycopeptides from wild-type and ΔaglG strains, use methods like SAINT (Significance Analysis of INTeractome) to identify significantly enriched substrates.

  • Bayesian network analysis: This approach can model interdependencies between glycosylation sites when proteins contain multiple potential modification sites.

Table 1: Example data format for analyzing AglG substrate specificity

ProteinUniProt IDGlycosite sequenceWild-type spectral countsΔaglG spectral countsp-valueSignificance
FlgA1D4GWY0MVINNTSTVE1510.0023***
PilA1D4GV79XXXNNXXXXX112220.0089**
PilA3D4GT29XXXNNXXXXX1900.0145*

How does AglG functionality compare across different archaeal species?

Comparative analysis of AglG homologs across archaeal species provides evolutionary insights and may reveal specialized adaptations. While the search results don't provide direct comparative data, researchers should consider:

  • Sequence homology analysis: Identify AglG homologs through BLAST searches against archaeal genomes, constructing phylogenetic trees to visualize evolutionary relationships.

  • Structural conservation assessment: Compare predicted protein structures to identify conserved catalytic domains versus variable regions that might confer species-specific substrate preferences.

  • Complementation studies: Test whether AglG from different species can restore glycosylation in H. volcanii ΔaglG mutants, assessing functional conservation.

  • Biochemical parameter comparison: Analyze enzyme kinetics, salt dependence, and temperature optima across species, correlating these with the organisms' natural habitats.

The functionality comparison should consider the ecological niches of different archaea. For example, species from varying salt concentrations might show adaptations in their glycosylation machinery. Cross-species comparisons can reveal whether AglG substrate specificity correlates with surface protein composition and environmental adaptation strategies.

How does AglG-mediated glycosylation influence archaeal biofilm formation?

AglG-mediated glycosylation likely plays a significant role in archaeal biofilm formation through its effects on cell surface properties. Research indicates that H. volcanii mating frequently occurs in biofilms, particularly under high-salt conditions where mating efficiency is enhanced . The glycosylation of surface proteins, including pilins (PilA1-6), directly impacts cellular adhesion properties . In the absence of proper N-glycosylation (as in ΔaglB strains), H. volcanii demonstrates altered microcolony formation patterns .

For researchers investigating this relationship, key methodological approaches should include:

  • Biofilm quantification using crystal violet staining, confocal microscopy, and biomass measurements in wild-type versus aglG-deficient strains.

  • Characterization of extracellular polymeric substance (EPS) composition in biofilms formed by strains with different glycosylation patterns.

  • Time-lapse microscopy to track the dynamics of biofilm formation under varying salt conditions, correlating with glycosylation efficiency.

  • Molecular force measurements between cells with different glycosylation patterns to quantify adhesion strength differences.

Understanding this relationship has implications for archaeal ecology in hypersaline environments, where biofilm formation may provide protection against environmental stressors.

What role might AglG play in archaeal adaptation to environmental stress?

AglG-mediated glycosylation appears to be part of the adaptive response of Haloferax volcanii to environmental stressors, particularly salt concentration changes. The research indicates that:

  • Different glycosylation patterns emerge under varying salt concentrations, suggesting glycosylation machinery adaptation to osmotic stress .

  • N-glycosylation plays a role in regulating the cellular response to low salt conditions, where wild-type H. volcanii becomes non-motile and forms microcolonies similar to ΔaglB strains under standard salt conditions .

  • The differential glycosylation of surface proteins may allow archaea to modulate their surface properties in response to changing environmental conditions.

For researchers investigating this relationship, systematic approaches should include:

  • Transcriptomic and proteomic analysis of aglG expression under various stressors (salt, temperature, pH).

  • Competitive growth assays between wild-type and aglG-deficient strains under fluctuating environmental conditions.

  • Characterization of glycan structures under different stress conditions to identify stress-specific modifications.

This research direction has implications for understanding how archaea adapt to extreme and changing environments, with potential insights for astrobiology and extremophile biotechnology applications.

How can structural analysis of AglG inform the engineering of glycosyltransferases with novel specificities?

Structural analysis of AglG can provide a foundation for rational engineering of glycosyltransferases with novel specificities. While specific structural data for AglG is not provided in the search results, a general approach would include:

  • Determining the crystal structure of AglG: This would reveal the spatial arrangement of catalytic residues, substrate binding pockets, and structural adaptations to high salt.

  • Computational modeling and docking: Use molecular dynamics simulations to model AglG interactions with various sugar donors and acceptors, identifying key interaction residues.

  • Structure-guided mutagenesis: Based on structural insights, design mutations that alter donor/acceptor specificity while maintaining catalytic efficiency.

  • Domain-swapping experiments: Exchange domains between AglG and other glycosyltransferases to create chimeric enzymes with hybrid specificities.

Engineering efforts should focus on both the sugar donor binding site (to alter sugar specificity) and the acceptor recognition domain (to modify protein substrate preference). Success would be measured by the ability to transfer novel sugar moieties or modify non-native protein substrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.