Recombinant Haloferax volcanii Glycosyltransferase AglJ (aglJ)

Shipped with Ice Packs
In Stock

Description

Introduction

Haloferax volcanii is a halophilic archaeon utilized as a model system to study archaeal N-glycosylation . N-glycosylation, the attachment of a glycan to a protein, is a post-translational modification that occurs in Archaea, Eukarya, and Bacteria . In H. volcanii, a series of Agl proteins mediate N-glycosylation . AglJ (previously named HVO_1517) is a glycosyltransferase involved in this process .

Role of AglJ in N-Glycosylation

AglJ adds the first hexose to the pentasaccharide that decorates the H. volcanii S-layer glycoprotein . The S-layer glycoprotein is the most dominant molecule on the surface of Haloferax cells and may mediate cell-cell recognition . Specifically, AglJ is involved in modifying one of the three H. volcanii monosaccharide-charged dolichol phosphates .

The N-glycosylation pathway and mutants can affect S-layer glycoprotein glycosylation and mating efficiency . Even minor changes in N-glycosylation, such as those resulting from the deletion of aglD, can perturb mating .

Study Findings

Mass spectrometry analysis has assigned AglJ a role in adding the first hexose to the pentasaccharide decorating the H. volcanii S-layer glycoprotein . Unlike other glycosyltransferases participating in H. volcanii N-glycosylation, the deletion of aglJ does not lead to N-linked glycans totally lacking the sugar subunit added by the glycosyltransferase in question; small amounts of hexose-modified dolichol phosphate and S-layer glycoprotein-derived peptide have been observed for cells lacking AglJ .

4.1. Impact on Monosaccharide-Charged Dolichol Phosphates

The monosaccharide-charged dolichol phosphate peak can be resolved into three distinct species . The absence of AglJ does not affect the first and third fractions, but the second peak is significantly reduced in cells lacking AglJ .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
aglJ; HVO_1517; Glycosyltransferase AglJ; Archaeal glycosylation protein J
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)
Target Names
aglJ
Target Protein Sequence
MPTPDAVCILTPTYNEAETIADVISDYRDEGFANVLVIDGGSTDGTRELAEDAGAHVVVQ SGSGKGQAVREAVEDHIQAPYVLMLDGDGTYEATDATKMLDPLTEGYDHVIGDRFADMRP GAMTRLNRVGNRIINRAFAFIHGQDFRDILSGYRAFTRESFLDMTLTSDGFGIETEMAVE CAKRGIKTTVVPTTYYPRPDGSDTNLDPIRDGGIIFLELYRRAKTNNPLFYFGSVGFAST ATGLGLALYVAYEWVVRSISHEVIAVVSMAGILFGVQLLMFGVLSDLILSLHREQMKRIE ELE
Uniprot No.

Target Background

Function

A glycosyltransferase involved in the assembly of the N-linked pentasaccharide decorating the S-layer glycoprotein and flagellins. It catalyzes the addition of the initial hexose subunit of the pentasaccharide to the dolichol phosphate carrier.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Glycosyltransferase AglJ and what is its function in Haloferax volcanii?

AglJ (encoded by gene aglJ, also known as HVO_1517) is a glycosyltransferase enzyme in Haloferax volcanii that plays a crucial role in N-linked protein glycosylation. Mass spectrometry analysis has demonstrated that AglJ specifically adds the first hexose sugar to the pentasaccharide that decorates the H. volcanii S-layer glycoprotein . This enzyme is essential for the initial step of the N-glycosylation pathway in this archaeon. When the aglJ gene is deleted, there is a significant reduction in monosaccharide-modified dolichol phosphate carriers and glycosylated S-layer glycoproteins, confirming its role as the initial glycosyltransferase in this pathway .

Why is Haloferax volcanii important as a model organism for archaeal research?

Haloferax volcanii, isolated from the Dead Sea in 1975, has emerged as a significant archaeal model system for several key reasons :

  • It thrives in high salt environments, making it an excellent model for studying halophilic adaptations

  • It is fast-growing and easily cultivated compared to many other archaea

  • An extensive repertoire of genetic, molecular biological, and biochemical tools has been developed for this organism

  • Its genome has been fully sequenced, enabling transcriptomic and proteomic studies

  • It has a low mutation rate and can grow on defined media, facilitating methodologies such as metabolic labeling

  • The collaborative spirit of the H. volcanii research community has made it valuable for understanding archaeal biology and developing biotechnology applications

These characteristics make H. volcanii particularly suitable for studying archaeal-specific processes like N-glycosylation and the function of enzymes such as AglJ .

What are the optimal methods for expressing and purifying recombinant AglJ?

Recombinant AglJ can be successfully expressed and purified using the following optimized methodology:

  • Expression system: The coding sequence of AglJ should be optimized and subcloned into a pET28a vector with an N-terminal 6xHis tag for expression in E. coli BL21(DE3) .

  • Auto-induction: An auto-induced expression system is recommended for high-level production of recombinant AglJ. This facilitates E. coli rapid growth to high densities and maximizes both folding efficiency and yield without requiring added inducers .

  • Purification protocol:

    • Use Ni-NTA affinity chromatography for initial purification

    • Gel-filtration chromatography can confirm that AglJ exists as a monomer in solution

    • The expected yield is typically around 650 mg/L culture medium when optimized

  • Storage conditions:

    • Store purified protein at -20°C/-80°C

    • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • For long-term storage, add 50% glycerol and aliquot to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

When properly expressed, the recombinant protein should appear as a band corresponding to approximately 43.0 kDa on SDS-PAGE, which aligns with the theoretically calculated molecular weight of 43.7 kDa for the 6xHis-tagged AglJ protein .

How can researchers verify the enzymatic activity of recombinant AglJ?

Verification of AglJ enzymatic activity requires multiple analytical approaches:

  • Mass spectrometry analysis:

    • Analyze both the glycopeptide products and the dolichol phosphate carrier levels

    • Compare wild-type and AglJ-deletion strains to identify specific glycan structures dependent on AglJ activity

    • Look for the signature hexose modification that AglJ adds to the N-linked glycan

  • Activity assay design:

    • Use UDP-glucose (UDPG) as the sugar donor

    • Set up reaction conditions at 37°C (typical incubation time: 3 hours)

    • Monitor product formation using HPLC with detection at 254 nm

    • Confirm product identity through LC-ESI-MS analysis

  • Comparative analysis:

    • When examining monosaccharide-charged dolichol phosphate in parent and AglJ-deletion strains, look for the specific reduction in the second peak resolved by LC/MS (approximately 7-fold decrease in intensity in deletion strains)

    • The first and third peaks should remain unaffected, confirming specificity of AglJ function

  • Control reactions:

    • Include reactions with lysates lacking AglJ to confirm the specificity of glycosylation activity

    • Verify that no new retention peaks appear when reaction conditions are adjusted in control samples

Researchers should note that unlike other glycosyltransferases in the H. volcanii N-glycosylation pathway (AglD, AglE, AglG, and AglI), deletion of AglJ does not completely eliminate the hexose-modified products, suggesting some level of redundancy or alternative pathways .

What are the challenges in expressing halophilic proteins like AglJ in heterologous hosts?

Expressing halophilic proteins such as AglJ from Haloferax volcanii in traditional heterologous hosts presents several significant challenges:

  • Protein folding and solubility issues:

    • Halophilic proteins are adapted to function in high salt environments

    • When expressed in non-halophilic hosts like E. coli, these proteins often misfold and aggregate due to different ionic conditions

    • This can lead to inclusion body formation and loss of enzymatic activity

  • Optimal expression conditions:

    • Conventional induction methods may not yield sufficient amounts of soluble protein

    • Auto-induction systems have proven more effective for obtaining halophilic proteins in functional form

    • Specialized expression vectors designed for halophilic proteins may be necessary

  • Purification complexities:

    • Halophilic proteins may require high salt concentrations during purification to maintain stability

    • Standard purification protocols often need modification to accommodate these requirements

    • Affinity tag selection becomes critical for successful purification

  • Post-translational modifications:

    • E. coli lacks the archaeal glycosylation machinery that may be necessary for full functionality

    • Native AglJ may undergo post-translational modifications in H. volcanii that aren't replicated in E. coli

  • Alternative expression systems:

    • The haloarchaeal expression system has been developed as an alternative for expressing halophilic proteins

    • This system allows for native-like conditions but may have lower yields compared to E. coli

    • Research on optimal affinity tags for the haloarchaeal expression system is ongoing

To overcome these challenges, researchers have developed optimized protocols using specific buffer conditions, expression temperatures, and inducer concentrations tailored for halophilic proteins .

How does AglJ function within the broader archaeal N-glycosylation pathway?

AglJ functions as a critical initial enzyme in the archaeal N-glycosylation pathway in Haloferax volcanii, with several distinctive characteristics:

  • Position in the pathway:

    • AglJ adds the first, as-yet-unidentified hexose to the pentasaccharide that decorates the H. volcanii S-layer glycoprotein

    • It acts on the dolichol phosphate carrier, initiating the assembly of the oligosaccharide that will eventually be transferred to target proteins

  • Substrate specificity:

    • Analysis of monosaccharide-charged dolichol phosphate pools indicates that AglJ specifically modifies only one of three H. volcanii monosaccharide-charged dolichol phosphates

    • When resolved by LC/MS, only the second of three peaks (distinguished by slightly different retention times) is significantly reduced (7-fold) in AglJ deletion strains

  • Redundancy in the pathway:

    • Unlike other glycosyltransferases in the H. volcanii N-glycosylation pathway (AglD, AglE, AglG, and AglI), deletion of AglJ does not completely eliminate hexose-modified products

    • Small amounts of hexose-modified dolichol phosphate and S-layer glycoprotein-derived peptide are still observed in cells lacking AglJ

    • This suggests some level of pathway redundancy or alternative mechanisms for adding the first hexose

  • Integration with other glycosyltransferases:

    • After AglJ adds the first sugar, other glycosyltransferases (AglD, AglE, AglG, and AglI) sequentially add the remaining sugars to complete the pentasaccharide structure

    • When these other glycosyltransferases are deleted, N-linked glycans completely lack the specific sugar subunit added by the respective enzyme

This integrated understanding of AglJ's role is essential for comprehending the complete archaeal N-glycosylation pathway and its unique features compared to bacterial and eukaryotic glycosylation systems.

What methodological approaches can be employed for studying substrate specificity of AglJ?

Investigating the substrate specificity of AglJ requires sophisticated methodological approaches that combine biochemical, analytical, and genetic techniques:

  • In vitro glycosylation assays:

    • Use purified recombinant AglJ with various potential sugar donors (beyond UDPG)

    • Test different acceptor substrates to determine range of specificity

    • Monitor product formation using HPLC (detection at 254 nm) and confirm with LC-ESI-MS analysis

    • Quantify conversion rates under standardized conditions

  • Mass spectrometry-based analysis:

    • Implement high-resolution LC/MS to resolve subtle differences in glycosylated products

    • Compare retention times and fragmentation patterns of products

    • Analyze monosaccharide-charged dolichol phosphate peaks, looking for characteristic modifications

    • Use MS/MS fragmentation to confirm the specific linkage positions of added sugars

  • Genetic approaches:

    • Create point mutations in the AglJ active site to identify key residues for catalysis and substrate binding

    • Generate chimeric enzymes with other glycosyltransferases to map domains responsible for sugar donor and acceptor specificity

    • Complement AglJ deletion strains with mutated versions to assess functionality in vivo

  • Structural biology techniques:

    • Obtain crystal structures of AglJ alone and in complex with substrates

    • Use computational docking to predict substrate binding modes

    • Implement molecular dynamics simulations to understand conformational changes during catalysis

  • Enzymatic cascade reactions:

    • Develop in vitro reconstitution of multi-enzyme cascades

    • Establish optimal enzyme ratios (e.g., UGT109A3:SUS ratio of 5:2 has been effective for similar glycosyltransferases)

    • Monitor conversion using analytical techniques like HPLC

  • NMR spectroscopy:

    • Use 1H and 13C NMR to characterize the glycosidic linkages formed by AglJ

    • Look for significant downfield shifts on the carbon signals and upfield shifts of the anomeric carbon signals

    • Employ HMBC (Heteronuclear Multiple Bond Correlation) to determine the exact positions of glycosylation

These methodologies provide complementary information about AglJ's substrate specificity and catalytic mechanism, offering a comprehensive understanding of this enzyme's function in archaeal glycobiology.

How can researchers troubleshoot issues with recombinant AglJ expression and activity?

When encountering challenges with recombinant AglJ expression and activity, researchers should implement the following systematic troubleshooting approaches:

  • Low expression yield issues:

    • Switch to auto-induction systems which have demonstrated superior results with halophilic proteins

    • Optimize codon usage for E. coli expression (AglJ's native codons may not be optimal)

    • Test different E. coli strains (BL21(DE3) has proven effective)

    • Adjust expression temperature (lower temperatures often improve folding of archaeal proteins)

    • Consider alternative vectors with different promoter strengths

  • Protein solubility problems:

    • Include osmolytes or salt in the lysis and purification buffers to mimic halophilic conditions

    • Test different lysis methods to preserve protein structure

    • Add stabilizing agents like trehalose (6%) to storage buffers

    • Consider fusion partners known to enhance solubility of archaeal proteins

  • Purification difficulties:

    • Optimize imidazole concentrations during Ni-NTA purification to reduce non-specific binding

    • Implement step-wise gradient elution to separate different protein populations

    • Consider alternative affinity tags if His-tag performance is suboptimal

    • Use gel filtration chromatography to confirm monomeric state and remove aggregates

  • Activity assay optimization:

    • Vary reaction conditions systematically (pH, temperature, salt concentration)

    • Test multiple sugar donors beyond UDPG

    • Optimize substrate concentrations based on enzyme kinetics

    • Include proper controls to distinguish enzymatic from non-enzymatic reactions

  • Storage stability issues:

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Add glycerol (recommended final concentration: 50%) for long-term storage

    • Store working aliquots at 4°C for up to one week

    • Confirm protein integrity after storage using activity assays and SDS-PAGE

If AglJ activity remains problematic in E. coli-expressed protein, researchers should consider alternative expression hosts, including the native H. volcanii expression system which may better preserve the natural folding and function of this halophilic enzyme .

What analytical methods are most effective for characterizing AglJ-mediated glycosylation products?

Comprehensive characterization of AglJ-mediated glycosylation products requires a multi-analytical approach:

  • HPLC analysis:

    • Use reverse-phase HPLC with UV detection at 254 nm to monitor reaction progress

    • Look for characteristic retention time shifts (products typically elute earlier than substrates)

    • Quantify conversion rates by comparing peak areas

    • Collect fractions for further structural analysis

  • Mass spectrometry:

    • LC-ESI-MS is essential for determining the molecular weight of glycosylated products

    • Look for characteristic mass shifts corresponding to the addition of hexose units (+162 Da)

    • For AglJ products, analyze both the glycopeptide and the dolichol phosphate carrier levels

    • Use high-resolution MS to resolve closely related species with similar retention times

  • NMR spectroscopy:

    • 1H and 13C NMR provide detailed structural information about glycosylation products

    • Look for specific spectral signatures:

      • Significant downfield shifts on the carbon signals (typically ~11.1 ppm)

      • Upfield shifts of the anomeric carbon signals (~11.0 ppm)

    • Use 2D NMR techniques like HMBC to confirm glycosidic linkage positions

    • Key correlations between anomeric proton signals and carbon atoms reveal the exact attachment points

  • Comparative analysis:

    • Always analyze products alongside standards and starting materials

    • Compare with glycosylation products from other characterized glycosyltransferases

    • Analyze products from wild-type and AglJ deletion strains to identify specific contributions

  • Tandem mass spectrometry (MS/MS):

    • Fragment glycosylated products to determine the exact structure and linkage information

    • Look for diagnostic fragment ions that reveal the position of glycosylation

    • Compare fragmentation patterns with those of authentic standards where available

Analytical MethodKey Information ProvidedTechnical ParametersSample Preparation Requirements
HPLCPurity, reaction progressDetection at 254 nmFiltered samples, appropriate solvent system
LC-ESI-MSMolecular weight, composition(M+H)+ ion detectionDesalted samples, MS-compatible solvents
NMR SpectroscopyLinkage position, anomeric configuration1H, 13C, 2D correlationsPurified products (mg quantities), deuterated solvents
MS/MSFragmentation patterns, structural confirmationCollision energy optimizationPurified products, ionization optimization

When implementing these methods for AglJ-mediated glycosylation, researchers should be attentive to the specific peak with retention time of approximately 20.23 min in HPLC and an (M+H)+ ion at m/z corresponding to the addition of a single hexose unit as observed in similar glycosyltransferase studies .

How can engineered AglJ variants contribute to synthetic glycobiology?

Engineered AglJ variants offer significant potential for advancing synthetic glycobiology through several innovative applications:

  • Expanded substrate specificity:

    • Rational protein engineering of AglJ's active site can potentially create variants with altered sugar donor preferences

    • Such engineered enzymes could incorporate non-natural sugars into glycan structures

    • This would enable the creation of novel glycoconjugates with unique properties for research and therapeutic applications

  • Biocatalytic cascade optimization:

    • Similar to UGT109A3-SUS cascade systems, AglJ could be incorporated into multi-enzyme cascades for efficient glycosylation

    • Optimizing enzyme ratios (e.g., 5:2 ratio as observed with UGT109A3:SUS) could enhance conversion rates

    • Engineering improved coupling between AglJ and sugar-regenerating enzymes would make the process more economical

  • Thermostability and solvent tolerance enhancement:

    • Directed evolution approaches could generate AglJ variants with improved stability

    • Enhanced stability would extend the utility of AglJ for industrial biocatalysis applications

    • Variants tolerant to organic solvents would enable new reaction formats beyond aqueous systems

  • Chimeric glycosyltransferases:

    • Creating fusion proteins between AglJ and other glycosyltransferases could generate enzymes with novel activities

    • Domain swapping between archaeal, bacterial, and eukaryotic glycosyltransferases may produce enzymes with unique specificities

    • Such chimeras could catalyze the formation of glycosidic linkages not found in nature

  • In vivo glycoengineering applications:

    • Heterologous expression of engineered AglJ variants in bacterial or yeast systems

    • Development of synthetic glycosylation pathways for producing defined glycostructures

    • Engineering prokaryotic systems capable of archaeal-type glycosylation for biotechnological applications

For implementing these applications, researchers should consider expression systems capable of producing high yields of soluble enzyme (>600 mg/L culture) and analytical methods that can accurately characterize the novel glycan products formed by engineered variants .

What insights does AglJ provide about the evolution of protein glycosylation across domains of life?

AglJ provides valuable evolutionary insights into protein glycosylation across life's domains:

These evolutionary insights position AglJ as not merely an archaeal enzyme but as a window into fundamental aspects of glycobiology across all domains of life.

What are the experimental considerations for studying AglJ in its native halophilic environment?

Studying AglJ in its native halophilic environment presents unique experimental challenges and requires specialized approaches:

  • Growth and cultivation of H. volcanii:

    • Use high-salt media (typically containing 1.5-3M NaCl) that mimics the hypersaline environment

    • Implement appropriate temperature controls (optimal growth at 42-45°C)

    • Consider the slower growth rates compared to model organisms like E. coli

    • Utilize defined media for controlled experiments, particularly for metabolic labeling

  • Genetic manipulation techniques:

    • Apply H. volcanii-specific genetic tools including expression vectors and gene-deletion strategies

    • Consider CRISPR-based approaches that have been adapted for halophilic archaea

    • Design primers and vectors accounting for the high GC content of H. volcanii DNA

    • Use appropriate selectable markers that function in high-salt conditions

  • Protein purification from native environment:

    • Maintain high salt concentration throughout purification to preserve protein structure and function

    • Implement dialysis strategies that gradually reduce salt concentration if needed for downstream applications

    • Consider detergent selection carefully when working with membrane-associated components of the glycosylation machinery

    • Use affinity tags that function reliably in high-salt conditions

  • Activity assays under halophilic conditions:

    • Design in vitro assays with salt concentrations that mimic cellular conditions

    • Account for altered enzyme kinetics in high-salt environments

    • Include appropriate controls to distinguish salt effects from substrate specificity

    • Consider the impact of ionic strength on substrate binding and catalysis

  • Structural biology considerations:

    • X-ray crystallography may require specialized approaches for halophilic proteins

    • Cryo-EM sample preparation needs optimization for high-salt samples

    • NMR studies must account for salt effects on chemical shifts and relaxation times

    • Protein-substrate interactions may differ significantly from those observed in low-salt conditions

  • Analytical method adaptations:

    • Mass spectrometry sample preparation requires careful desalting procedures

    • HPLC methods may need optimization for high-salt samples

    • Consider the impact of salt on chromatographic separation and resolution

    • Develop specialized protocols for glycan isolation from halophilic samples

By addressing these considerations, researchers can effectively study AglJ in its native context, providing more physiologically relevant insights than those obtained solely from heterologous expression systems .

What are the most promising future research directions for AglJ and archaeal glycosyltransferases?

The study of AglJ and related archaeal glycosyltransferases presents several promising research frontiers:

  • Structural biology approaches:

    • Determining high-resolution crystal structures of AglJ alone and in complex with substrates

    • Using cryo-EM to visualize the entire archaeal glycosylation machinery in action

    • Employing hydrogen-deuterium exchange mass spectrometry to map dynamic conformational changes during catalysis

  • Synthetic biology applications:

    • Engineering AglJ for creating novel glycoconjugates with biomedical applications

    • Developing cell-free glycosylation systems based on archaeal enzymes

    • Creating minimal glycosylation pathways for producing defined glycan structures

  • Evolutionary glycobiology:

    • Comprehensive comparative analysis of glycosyltransferases across archaeal species

    • Reconstructing ancestral glycosyltransferases to understand evolutionary trajectories

    • Investigating horizontal gene transfer events in the evolution of glycosylation pathways

  • Advanced analytical tools:

    • Implementing glycoproteomics approaches to comprehensively map the H. volcanii glycoproteome

    • Developing techniques for single-molecule imaging of glycosylation reactions

    • Applying systems biology approaches to model glycosylation pathway dynamics

  • Physiological relevance studies:

    • Investigating the impact of altered glycosylation on archaeal biofilm formation

    • Exploring the role of protein glycosylation in archaeal adaptation to extreme environments

    • Examining glycosylation changes in response to environmental stressors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.