Recombinant Haloferax volcanii Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Mechanistic Insights

  • Sec Pathway Integration: SecD partners with SecF to form a membrane-bound complex that stabilizes translocating polypeptides and assists in their folding. Unlike bacteria, archaea lack SecA ATPase and SecG, suggesting functional divergence .

  • Phenotypic Effects: Deletion of the secFD operon in H. volcanii results in:

    • Severe cold sensitivity (growth impairment below 30°C) .

    • Impaired secretion of Sec-dependent substrates (e.g., serine proteases) .

  • Evolutionary Conservation: Despite structural differences in translocation machineries, archaeal SecD/SecF functionally overlaps with bacterial homologs in late-stage translocation .

Experimental Validation

  • Epitope Tagging: C-terminal hexahistidine-tagged SecD retains functionality, enabling co-immunoprecipitation studies confirming its interaction with SecF .

  • Genetic Knockout: ΔsecFD strains exhibit defective protein export, rescued by plasmid-borne secFD reintroduction .

Recombinant Expression

  • Cloning Strategies: The secFD operon (including 340 bp upstream regulatory DNA) is amplified via PCR and inserted into H. volcanii-E. coli shuttle vectors (e.g., pMLH3) .

  • Purification: Nickel-affinity chromatography isolates His-tagged SecD from E. coli lysates, yielding >90% pure protein .

Research Applications

  • Structural Studies: Used in crystallography and cryo-EM to map archaeal translocon architecture .

  • Functional Assays: Reconstituted into proteoliposomes to study ATP-independent translocation mechanisms .

  • Antibody Development: Serves as an antigen for generating SecD-specific antibodies .

Challenges and Future Directions

  • Thermostability: While stable under high salinity (native to H. volcanii), recombinant SecD requires glycerol buffers to prevent aggregation in vitro .

  • Interactome Mapping: Ongoing studies aim to identify binding partners (e.g., signal peptidases) to elucidate regulatory networks .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please communicate it to us. We will prioritize developing the specified tag if feasible.
Synonyms
secD; HVO_1976; Protein-export membrane protein SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)
Target Names
secD
Target Protein Sequence
MSTLRDNWRVIFLVAAILLSTFALFSPTMGNQSPIGEDDSATNLQFGLQLDGGTRIRAPL VGVTAEDVEFEGDSERVVERQVAAQIAGADAADIIVRTGAESSTVEATIENVTADDLSAA LDAAGYAHGEVRDGVTGTTRAETVRVLQSKINEAGLSGGTVQQVTTATGEHFILVEVPNR DQSDVVDLVGERGTVQIDIYYPTGTDNGSRTYETREAVLTQADFTSIGTAQESQTGSGAF VPVSVRDDPAAEFQTAIQDTGLAQPGGTRCTYMEDGGRNTTEGCLLLVVNGEVVNAFGMS GGLADTMRAGEWAGAPSFQLQTRNTSEAQEIAINLRAGALPARLDLSGEDSGTSSYISPS QGESFKFDSLITGIVAVLAVAGVVFIRYGKPQVALPMIVTGLSEVYILLGFAAAIGYPLD LSVIAGFIAVIGTGVDDLIIIADEVMGEGSVKSRKVFQSRFRRAFWVIGAAAATTIIAMS PLAVLSLGDLQGFAIFTILGVIVGVLVTRPAYGDILRLLLTEDR
Uniprot No.

Target Background

Function
Plays a role in protein export.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of SecD in Haloferax volcanii?

SecD in H. volcanii is a protein translocase subunit that forms a complex with SecF in the cytoplasmic membrane. This complex plays an essential role in protein secretion across the membrane. Studies with deletion mutants (ΔsecFD) have demonstrated that these proteins are crucial for proper protein translocation .

How is the structure and topology of H. volcanii SecD characterized?

Although detailed atomic structures are not available specifically for H. volcanii SecD, the predicted topology indicates it is a multi-spanning membrane protein. The conservation in predicted topology between bacterial and archaeal SecD proteins points to the fundamental importance of this arrangement for function across different domains of life .

How does the Sec translocation system in archaea differ from bacteria?

The Sec translocation system in archaea exhibits a fascinating hybrid nature:

  • Core translocon: The archaeal core machinery resembles the eukaryotic Sec61 complex more than the bacterial SecYEG complex .

  • Accessory components: Interestingly, archaea possess bacterial-like SecD and SecF homologs despite lacking other bacterial components like SecA and SecG .

  • Operon structure: Like in many bacteria, archaeal secD and secF genes are organized in an operon, but unlike many bacterial species, archaeal genomes (including H. volcanii) lack a yajC homolog .

  • Functional conservation: Despite these compositional differences, deletion of secFD in H. volcanii results in similar phenotypes to bacterial secDF deletions, including cold sensitivity and translocation defects .

This hybrid nature makes archaeal Sec systems particularly interesting for studying the evolution and fundamental mechanisms of protein translocation across membranes.

What expression systems are most effective for recombinant H. volcanii SecD?

For expression of recombinant H. volcanii SecD, researchers should consider the following approaches:

  • Homologous expression in H. volcanii:

    • Advantages: Proper folding in native halophilic environment, correct post-translational modifications

    • Methodology: Use vectors with inducible promoters designed for H. volcanii, incorporate affinity tags for purification

    • Considerations: Lower yields compared to heterologous systems, but higher likelihood of functional protein

  • Heterologous expression in E. coli:

    • Advantages: Higher yields, well-established protocols

    • Methodology: Codon optimization for E. coli, use of specialized strains (C41, C43) for membrane proteins

    • Considerations: Expression in high salt (2-3M NaCl) conditions to maintain proper folding of halophilic proteins

    • Optimization: Addition of fusion partners (MBP, SUMO) to improve solubility and folding

  • Cell-free expression systems:

    • Advantages: Rapid, scalable, avoids toxicity issues

    • Methodology: Supplement with liposomes or nanodiscs for membrane protein insertion

    • Considerations: Use of halophilic cell extracts or high-salt buffers required for proper folding

The choice of system depends on the specific research goals. For structural studies or in vitro assays, E. coli or cell-free systems optimized for high yields may be preferable, while functional studies might benefit from homologous expression to ensure native characteristics.

How can researchers analyze the interaction between SecD and SecF in H. volcanii?

To study the SecD-SecF interaction in H. volcanii, which has been confirmed to form a cytoplasmic membrane complex , several methodological approaches can be employed:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of SecD and SecF (e.g., His-tagged SecD and FLAG-tagged SecF)

    • Solubilize membranes with mild detergents (DDM, LDAO) that preserve protein-protein interactions

    • Perform pull-down assays and identify interaction partners by Western blotting

  • Förster Resonance Energy Transfer (FRET):

    • Create fusion proteins with appropriate fluorescent proteins

    • Monitor FRET signals in vivo to detect interactions and potential conformational changes

    • Allows for real-time analysis of dynamic interactions

  • Cross-linking studies:

    • Use chemical cross-linkers of varying spacer lengths to stabilize transient interactions

    • Identify cross-linked products by mass spectrometry

    • Map interaction interfaces through site-specific cross-linking

  • Genetic suppressor analysis:

    • Identify mutations in secF that suppress specific secD mutations or vice versa

    • Map genetic interactions to understand functional relationships

These approaches can help determine not only the physical interaction between SecD and SecF but also how this interaction contributes to the function of the protein translocation machinery in archaea.

What methodologies can be used to create and validate ΔsecD mutants in H. volcanii?

Creating and validating ΔsecD mutants in H. volcanii requires specific methodological approaches suitable for archaeal genetic manipulation:

  • Construct design:

    • Create a deletion construct with homologous flanking regions upstream and downstream of secD

    • Include selectable markers appropriate for H. volcanii (e.g., pyrE2 for uracil selection)

    • Consider potential polar effects on secF expression if they share an operon

  • Transformation and selection:

    • Transform H. volcanii using polyethylene glycol-mediated method

    • Select transformants on appropriate selective media

    • Apply counter-selection strategy to isolate clean deletions

  • Validation methods:

    • PCR verification with primers spanning the deletion junction

    • RT-PCR to confirm absence of secD transcript

    • Western blotting with anti-SecD antibodies

    • Phenotypic characterization including:

      • Growth analysis at normal and reduced temperatures (cold sensitivity is expected based on ΔsecFD phenotype)

      • Protein secretion profiling to identify translocation defects

  • Complementation analysis:

    • Reintroduce secD on an expression plasmid

    • Confirm restoration of wild-type phenotypes

    • This control confirms phenotypes are specifically due to secD deletion

The search results indicate that a ΔsecFD deletion strain has been successfully created in H. volcanii and exhibits both cold sensitivity and protein translocation defects , providing a framework for expected phenotypes of a secD-specific deletion.

What phenotypic assays can effectively measure SecD function in H. volcanii?

Based on the known phenotypes of ΔsecFD mutants, several assays can effectively measure SecD function in H. volcanii:

  • Temperature sensitivity analysis:

    • Quantitative growth curves at various temperatures

    • Colony formation efficiency at reduced temperatures

    • This is particularly important as ΔsecFD mutants exhibit severe cold sensitivity

  • Protein secretion profiling:

    • Analyze culture supernatant proteins by SDS-PAGE and mass spectrometry

    • Compare secretion profiles between wild-type and ΔsecD strains

    • Identify specific Sec-dependent proteins affected by the mutation

  • Reporter protein translocation assays:

    • Express fusion proteins with a Sec signal sequence and detectable reporter

    • Quantify reporter activity in cellular fractions to measure translocation efficiency

    • Particularly useful for measuring the Sec-specific protein translocation defect observed in ΔsecFD mutants

  • Membrane stress response:

    • Monitor expression of stress response genes

    • Test sensitivity to membrane-targeting compounds

  • Protein localization microscopy:

    • Fluorescently tag Sec substrates

    • Visualize localization defects in ΔsecD mutants

These assays provide complementary data to comprehensively assess how SecD affects protein translocation in H. volcanii and can help determine the specific role of SecD in the archaeal Sec pathway.

What purification strategies are most effective for halophilic membrane proteins like H. volcanii SecD?

Purifying halophilic membrane proteins like H. volcanii SecD requires specialized approaches:

  • Membrane extraction optimization:

    • Isolate membrane fractions through differential centrifugation

    • Test multiple detergents for solubilization (DDM, LDAO, CHAPS)

    • Critical parameter: Maintain high salt concentration (2-3M NaCl) throughout all purification steps to prevent denaturation of halophilic proteins

  • Affinity chromatography considerations:

    • IMAC (Immobilized Metal Affinity Chromatography) for His-tagged proteins with adjusted imidazole concentrations for high salt conditions

    • Anti-FLAG or Strep-Tactin columns for alternatively tagged constructs

    • On-column detergent exchange can improve downstream applications

  • Size exclusion chromatography:

    • Separate monomeric SecD from SecD-SecF complexes or aggregates

    • Monitor complex formation with SecF

    • Buffer composition: High salt (2-3M NaCl) with selected detergent at concentrations above CMC

  • Specialized techniques for halophilic proteins:

    • Consider nanodisc or amphipol reconstitution for improved stability

    • Detergent screening panel to identify conditions that maintain native structure

    • Quality control through SEC-MALS and circular dichroism to verify proper folding in high salt

The table below summarizes key differences in purification strategies for halophilic versus non-halophilic membrane proteins:

ParameterStandard Membrane ProteinsHalophilic Membrane Proteins (H. volcanii SecD)
Salt concentration100-300 mM NaCl2-3M NaCl throughout purification
Detergent selectionStandard screeningMust be compatible with high salt
Buffer pHTypically pH 7-8Often higher pH (pH 8-9)
Stability concernsGeneral aggregationDenaturation in low salt
Refolding potentialPossible with some protocolsExtremely difficult once denatured

How can researchers analyze the membrane topology of SecD in H. volcanii?

Understanding the membrane topology of SecD is crucial for functional studies. According to search results, H. volcanii SecD has a predicted membrane topology identical to E. coli SecD . To experimentally verify and analyze this topology:

  • Protease accessibility mapping:

    • Create inside-out and right-side-out membrane vesicles

    • Treat with proteases of varying specificities

    • Analyze protected fragments by mass spectrometry or Western blotting

    • Identifies which regions are exposed to cytoplasm versus exterior

  • Cysteine accessibility methods:

    • Introduce cysteine residues at predicted loop regions

    • Treat with membrane-permeable and non-permeable thiol-reactive reagents

    • Determine accessibility pattern to confirm topology predictions

  • Fusion protein approach:

    • Create fusions with reporter proteins (GFP, PhoA) at various positions

    • Reporter activity depends on cellular localization (cytoplasmic vs. periplasmic)

    • Provides experimental validation of topology models

  • Epitope insertion strategy:

    • Insert small epitope tags (FLAG, HA) at predicted loop regions

    • Determine accessibility by immunofluorescence or flow cytometry

    • Differentiates between cytoplasmic and external domains

  • Cryo-electron microscopy:

    • Visualize SecD structure directly within the membrane

    • Particularly valuable if performed on the SecD-SecF complex

How can researchers distinguish between direct and indirect effects of SecD deletion?

When analyzing ΔsecD phenotypes, distinguishing direct from indirect effects requires methodical approaches:

  • Immediate versus long-term effects:

    • Use inducible or regulated systems to deplete SecD

    • Monitor time-course of phenotypic changes following depletion

    • Early effects are more likely to be direct consequences of SecD loss

  • Substrate specificity analysis:

    • Examine a panel of known Sec-dependent and Sec-independent proteins

    • Identify specific characteristics of affected proteins

    • Create a profile of properties that make a protein dependent on SecD function

  • Suppressor mutation analysis:

    • Identify mutations that suppress ΔsecD phenotypes

    • Distinguish between specific suppressors (directly restoring SecD function) and general suppressors (compensating through other pathways)

    • Map suppressor mutations to specific protein interaction networks

  • In vitro reconstitution:

    • Purify components of the Sec machinery with and without SecD

    • Directly measure SecD-dependent activities in controlled conditions

    • Eliminates cellular complexity to focus on direct effects

  • Comparative analysis across species:

    • Compare SecD function in H. volcanii with other archaea and bacteria

    • Identify conserved versus species-specific effects

    • The search results show functional conservation between bacterial and archaeal SecD/F despite differences in other parts of their translocation machineries

These methodologies help separate the direct impacts of SecD loss from downstream cellular responses, providing clearer insights into the specific role of SecD in archaeal protein translocation.

What does the cold sensitivity of ΔsecFD mutants reveal about SecD function?

The severe cold sensitivity observed in H. volcanii ΔsecFD mutants provides important mechanistic insights:

  • Mechanistic implications:

    • Cold sensitivity typically indicates defects in protein folding or assembly processes

    • Lower temperatures reduce molecular motion and can exacerbate defects in protein insertion

    • This suggests SecD/F may facilitate membrane protein folding or stability during translocation

  • Evolutionary significance:

    • The conservation of this phenotype between E. coli and H. volcanii ΔsecFD mutants despite their distinct translocation machineries indicates a fundamental and ancient role

    • This shared phenotype transcends the differences in other components (presence/absence of SecA, SecG, YajC)

  • Quantitative analysis framework:

    • Growth rate measurements at temperature series (37°C, 30°C, 25°C, 20°C, 15°C)

    • Calculate relative growth inhibition at each temperature

    • Determine thermal threshold where growth becomes severely compromised

  • Molecular basis hypotheses:

    • Reduced efficiency of protein translocation at lower temperatures

    • Accumulation of untranslocated precursors in the cytoplasm

    • Membrane stress due to improper protein insertion

    • Activation of stress response pathways that further impair growth

This cold sensitivity provides a valuable phenotypic assay for studying SecD function and testing complementation by modified SecD proteins or suppressors.

How do archaeal and bacterial SecD/F complexes compare functionally and structurally?

The comparison between archaeal and bacterial SecD/F reveals fascinating evolutionary conservation and adaptation:

FeatureBacterial SecD/F (E. coli)Archaeal SecD/F (H. volcanii)Significance
Complex formationSecD-SecF-YajC complexSecD-SecF complex (no YajC)Evolutionary divergence in accessory components
Genetic organizationOften in operonsecFD operonConservation of genetic organization
Membrane topologyMulti-spanning membrane proteinsIdentical to bacterial homologsStructural conservation despite sequence divergence
Associated componentsFunctions with SecA, SecGFunctions without SecA or SecG homologsAdaptation to different translocation machinery
Deletion phenotypeCold sensitivity, translocation defectsCold sensitivity, translocation defectsFunctional conservation despite different contexts
Proposed mechanismSecA cycling, SecG stabilizationUnknown, but essential for efficient translocationMechanistic adaptation to archaeal Sec system

What specific translocation defects occur in the absence of SecD/F in H. volcanii?

The H. volcanii ΔsecFD deletion strain exhibits a Sec-specific protein translocation defect . The specifics of this defect include:

  • Substrate specificity:

    • Affects Sec-dependent proteins specifically

    • Non-Sec-dependent proteins remain properly localized

    • Indicates a pathway-specific rather than general membrane defect

  • Nature of the defect:

    • Based on bacterial studies and conservation of phenotypes, likely involves:

      • Reduced efficiency of translocation

      • Potential accumulation of translocation intermediates

      • Possible misfolding of membrane proteins following insertion

  • Quantitative aspects:

    • The severity of the defect is temperature-dependent, becoming more pronounced at lower temperatures

    • This temperature dependence suggests a kinetic component to SecD/F function

  • Comparative analysis:

    • Similar protein translocation defects in bacterial and archaeal ΔsecFD mutants despite their distinct translocation machineries

    • This conservation suggests a fundamental role in the translocation process that is independent of other components like SecA and SecG

The protein translocation defect in H. volcanii ΔsecFD mutants provides strong evidence that despite the absence of bacterial components like SecA and SecG, archaeal SecD/F plays an essential role in the Sec-dependent protein translocation pathway that is functionally conserved across prokaryotes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.