Recombinant Halomonas halodenitrificans Nitric oxide reductase subunit C (norC)

Shipped with Ice Packs
In Stock

Description

Introduction

The Halomonas halodenitrificans nitric oxide reductase subunit C (norC) is a component of the enzyme nitric oxide reductase, which is involved in denitrification . Denitrification is a microbial process that reduces nitrogen oxides, such as nitrate, to dinitrogen gas, thus removing fixed nitrogen from the environment . This process is important in wastewater treatment and in the global nitrogen cycle .

Halomonas halodenitrificans

Halomonas halodenitrificans is a species of moderately halophilic bacteria, which means it thrives in environments with moderate salt concentrations . Halomonas species are known for their ability to tolerate a wide range of environmental conditions and have been found in various saline habitats . They are also notable for their metabolic versatility, including the ability to perform aerobic denitrification .

Nitric Oxide Reductase (NOR)

Nitric oxide reductase (NOR) is a crucial enzyme in the denitrification pathway, catalyzing the reduction of nitric oxide (NO) to nitrous oxide (N₂O) . NOR is a complex enzyme consisting of multiple subunits, including NorC .

Subunit C (NorC)

NorC is one of the subunits of nitric oxide reductase. While the exact function of NorC is not fully elucidated, it is believed to play a role in the structural integrity and/or electron transfer processes of the NOR enzyme complex .

Recombinant NorC

Recombinant NorC refers to NorC that is produced through recombinant DNA technology. This involves isolating the gene encoding NorC from Halomonas halodenitrificans, cloning it into a suitable expression vector, and then expressing the protein in a host organism, such as Escherichia coli . The recombinant protein can then be purified and studied in vitro .

Role of NoRC in Chromatin Remodeling

NoRC (nucleolar remodeling complex) is a complex involved in ribosomal DNA (rDNA) transcription regulation and heterochromatin formation, which is different from NorC (nitric oxide reductase subunit C) . NoRC contains TIP5 and SNF2h subunits and has chromatin-stimulated ATPase activity and mobilizes nucleosomes . NoRC-associated RNA (pRNA) is essential for NoRC's localization and gene silencing functions .

Potential Applications

The study of recombinant NorC from Halomonas halodenitrificans and its role in denitrification has several potential applications:

  • Bioremediation: Understanding the denitrification capabilities of Halomonas species can aid in developing bioremediation strategies for removing nitrogen pollutants from contaminated environments .

  • Wastewater Treatment: Halomonas can be used in wastewater treatment processes to remove excess nitrogen, which contributes to eutrophication .

  • Agricultural Applications: Understanding the regulation of denitrification can help reduce the emission of nitrous oxide, a potent greenhouse gas, from agricultural soils .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
norC; Nitric oxide reductase subunit C; NOR small subunit; Nitric oxide reductase cytochrome c subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-150
Protein Length
Full Length of Mature Protein
Species
Halomonas halodenitrificans (Paracoccus halodenitrificans)
Target Names
norC
Target Protein Sequence
ADGLTKSAARNIFYGGSLFFFLLFAALTAHSHWYMVNKSTDNEGLTESVVAGKHIWEKNM CINCHSIMGEGAYFAPELSNVWERYGGHQNPEAARAGLAAWIRAQPLGTQGRRQMPAYDF TDEEMSSLIDFLEWTDGIDDQDWPPHPAG
Uniprot No.

Target Background

Function
A component of the anaerobic respiratory chain, it catalyzes the reduction of nitrate to dinitrogen (denitrification).
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural organization of Halomonas halodenitrificans nitric oxide reductase?

Halomonas halodenitrificans nitric oxide reductase (NOR) is a membrane-bound heterodimer complex composed of two principal subunits: NorC and NorB. The NorC subunit contains a low-spin heme c center, while the NorB subunit houses a more complex arrangement of metal centers including a low-spin heme b center, a high-spin heme b3 center, and a non-heme FeB center . This heterodimeric arrangement is characteristic of cytochrome c-dependent NORs (cNORs), which are found predominantly in denitrifying bacteria.

The NorC subunit contains an N-terminal membrane anchor region (approximately the first 37 amino acids in H. halodenitrificans) that tethers the protein to the membrane, followed by a soluble periplasmic domain containing the heme c cofactor. This structural organization allows NorC to function as an electron transfer interface between soluble electron donors in the periplasm and the catalytic center in NorB .

NOR belongs to the heme-copper oxidase superfamily, though it contains iron instead of copper at its active site. The catalytic center, housed in NorB, comprises a binuclear center with a high-spin heme b3 and a non-heme iron (FeB) in close proximity, which provides the active site for NO reduction .

What are the different families of nitric oxide reductases and how does H. halodenitrificans NOR relate to them?

Research has identified three principal classes of bacterial nitric oxide reductases that differ in their structural organization and electron donor preferences:

  • cNOR (cytochrome c-dependent NOR): These are heterodimeric proteins consisting of NorC and NorB subunits. The NorC subunit contains a heme c center that accepts electrons from periplasmic cytochrome c or other electron donors. H. halodenitrificans NOR belongs to this class .

  • qNOR (quinol-dependent NOR): These enzymes accept electrons from reduced quinol rather than cytochrome c. They lack the NorC subunit but contain a catalytic subunit homologous to NorB with an N-terminal extension that facilitates electron transfer from quinol. This form is designated as NorZ or qnorB in different organisms .

  • CuANOR: This less common variant has been identified in certain bacteria and archaea .

Each class employs different electron transfer pathways, though they all catalyze the same fundamental reaction: 2NO + 2e⁻ + 2H⁺ → N₂O + H₂O. In H. halodenitrificans NOR (a cNOR), electrons flow from periplasmic electron donors to the heme c in NorC, then to the low-spin heme b in NorB, and finally to the catalytic binuclear center comprising heme b3 and non-heme FeB .

What is the biological role of nitric oxide reductase in denitrification?

Nitric oxide reductase plays a crucial role in the denitrification pathway, which is a form of anaerobic respiration employed by many bacteria including H. halodenitrificans. In this process, nitrate (NO₃⁻) is sequentially reduced to nitrogen gas (N₂) through several intermediates: nitrite (NO₂⁻), nitric oxide (NO), nitrous oxide (N₂O), and finally N₂ .

Within this pathway, NOR specifically catalyzes the reduction of nitric oxide (NO) to nitrous oxide (N₂O), representing the third step in the complete denitrification process. This reaction is particularly important for two reasons: (1) it detoxifies NO, which is cytotoxic even at low concentrations, and (2) it contributes to energy conservation through the respiratory electron transport chain .

Denitrification is significant in the global nitrogen cycle, affecting nitrogen availability in soils and contributing to greenhouse gas emissions through N₂O production. The enzymatic mechanisms of NORs have attracted significant research interest due to their environmental importance and potential applications in bioremediation and biotechnology .

What strategies have been developed for heterologous expression of H. halodenitrificans norC in E. coli?

Researchers have developed several strategies for the heterologous expression of H. halodenitrificans norC in E. coli, addressing the challenges inherent in membrane protein expression:

  • Expression of truncated NorC (NorC*): The soluble domain of NorC, designated as NorC* (ΔMet1-Val37), has been successfully expressed by removing the 84 5'-terminal nucleotides that encode the N-terminal membrane anchor. This approach circumvents the difficulties associated with membrane protein expression while preserving the functional electron transfer domain containing the heme c center .

  • Full-length norC expression: When attempting to express the complete norC gene including the membrane anchor sequence, researchers observed that E. coli cellular machinery naturally performed an analogous scission of the N-terminal helix that serves as the membrane anchor. This suggests that E. coli recognizes and processes the membrane-targeting signals in the full-length norC sequence .

  • Co-expression with cytochrome c maturation (ccm) genes: Successful expression of functional norC requires proper incorporation of the heme c cofactor. This is achieved by co-expressing the ccm gene cluster, which encodes proteins essential for the maturation of c-type cytochromes in E. coli, ensuring proper covalent attachment of the heme to the protein backbone .

  • Expression of the complete NOR complex: For expression of the entire functional NOR complex, researchers used a plasmid containing all genes in the nor operon (norCBQDX) with modifications including deletion of three hairpin loops in the mRNA structure. This approach, combined with co-expression of the ccm genes, yielded recombinant NOR (rNOR) with spectroscopic properties similar to the native enzyme .

These strategies demonstrate the importance of addressing both protein folding and cofactor incorporation for successful heterologous expression of norC and the complete NOR complex.

What challenges exist in expressing the full NOR complex and how can they be overcome?

Expressing the full nitric oxide reductase complex in a heterologous system presents several significant challenges:

  • Membrane protein integration: Both NorC and NorB are membrane proteins requiring proper integration into the host cell membrane. While NorC has only a single N-terminal membrane anchor, NorB is more complex with multiple transmembrane helices, making its expression particularly challenging .

  • Complex cofactor assembly: The NOR complex contains multiple cofactors including heme c in NorC, as well as heme b, heme b3, and non-heme iron (FeB) in NorB. Proper incorporation of these cofactors requires specific biosynthetic and assembly machinery that may not be natively present in the expression host .

  • mRNA secondary structure interference: Secondary structures in the mRNA can impede translation. Researchers found that deletion of three hairpin loops in the nor operon mRNA was necessary for successful expression of the complete NOR complex .

  • Cytochrome c maturation: Proper maturation of c-type cytochromes requires specific machinery for covalent attachment of heme to the protein backbone via thioether bonds to cysteine residues .

These challenges have been addressed through several strategies:

  • Using a plasmid harboring all genes in the nor operon (norCBQDX) rather than attempting to express NorB alone, which was unsuccessful .

  • Modifying the expression construct by deleting three hairpin loops in the mRNA structure that might interfere with translation efficiency .

  • Co-expressing the ccm genes for cytochrome c maturation, ensuring proper incorporation of the heme c cofactor in NorC .

  • Optimizing growth and induction conditions to balance protein expression with membrane integration capacity of the host cells .

Despite these strategies, recombinant NOR showed considerably decreased enzymatic activity toward NO compared to the native enzyme, indicating that additional optimization may be necessary to achieve fully functional expression .

How can researchers assess the purity and functionality of recombinant norC?

Assessment of recombinant norC purity and functionality involves multiple complementary techniques:

For purity assessment:

  • SDS-PAGE analysis: This technique allows visualization of protein purity through separation based on molecular weight. Pure norC appears as a distinct band corresponding to its expected molecular weight (approximately 17-20 kDa for the soluble domain). When purifying the complete NOR complex, two distinct bands corresponding to the α subunit (NorB, 35-40 kDa) and β subunit (NorC) should be visible .

  • UV-Visible spectroscopy: Pure cytochrome c-containing proteins like NorC exhibit characteristic absorbance peaks. The ratio of the Soret band absorbance (around 410 nm) to the protein absorbance at 280 nm (A410/A280) provides a measure of purity, with a ratio of approximately 1.3 indicating high purity .

For functionality assessment:

  • Spectroscopic characterization: NorC* should exhibit spectra typical of a low-spin heme c center. Changes in the spectrum upon reduction can confirm proper incorporation of the heme cofactor .

  • Electron transfer capability: Functional NorC* should act as an electron acceptor from cytochrome c isolated from the periplasm of H. halodenitrificans or from small reducing agents. This can be assessed through spectroscopic methods or electrochemical techniques .

  • Redox potential measurements: The redox potential of recombinant NorC* can be determined and compared to that of native NorC. Research has shown that NorC* exhibits a redox potential shifted by approximately 40 mV in the negative direction compared to native NorC, likely due to structural differences resulting from truncation .

  • Activity assays for the complete NOR complex: When expressing the full complex, NO reduction activity can be measured using established assays. The specific activity (μmol NO reduced/min/mg protein) provides a quantitative measure of enzyme functionality .

These assessment techniques provide comprehensive information about both the structural integrity and functional capabilities of recombinant norC.

What spectroscopic and electrochemical methods are suitable for analyzing norC?

Several spectroscopic and electrochemical techniques have proven valuable for characterizing the structure and function of norC:

Spectroscopic Methods:

  • UV-Visible absorption spectroscopy: This fundamental technique reveals characteristic absorption bands of the heme c cofactor in norC. The reduced form typically shows sharp α and β bands at approximately 550 and 520 nm, respectively, while the oxidized form exhibits a broader absorption profile. This method is useful for confirming proper heme incorporation and monitoring redox state changes .

  • Resonance Raman spectroscopy: This technique provides detailed information about the heme environment and coordination state by selectively enhancing vibrations of the heme group. It can distinguish between different spin and oxidation states of the heme iron .

  • Electron Paramagnetic Resonance (EPR): EPR spectroscopy detects unpaired electrons and can provide information about the electronic structure of the heme centers in different oxidation states. This is particularly useful for characterizing the paramagnetic centers in the NOR complex .

Electrochemical Methods:

  • Cyclic voltammetry (CV): CV has been successfully applied to NOR studies, revealing the electrochemical behavior of the different redox centers. For example, at scan rates of 0.10-2.0 V/s, distinct oxidation and reduction peaks corresponding to the heme centers can be observed, allowing determination of formal potentials and electron transfer kinetics .

  • Square-wave voltammetry: This technique offers enhanced sensitivity compared to CV and has been used to resolve the redox potentials of the different metal centers in NOR. When applied to NOR at frequencies of 20-150 Hz, it can distinguish between non-heme FeB, heme b3, heme b, and heme c peak centers .

  • Chronoamperometry: This technique allows real-time measurement of catalytic currents during substrate (NO) reduction, providing insights into the kinetics of the enzymatic reaction .

  • Pyrolytic graphite edge (PGE) electrodes: These electrodes have been successfully used as platforms for direct electrochemistry of NOR, enabling direct electron transfer between the electrode and the enzyme without mediators .

These methods, often used in combination, provide comprehensive insights into the structural integrity, cofactor coordination, redox properties, and catalytic capabilities of norC and the complete NOR complex.

What mechanisms have been proposed for NO reduction by NOR and how can recombinant norC help in elucidating them?

Three principal mechanisms have been proposed for the reduction of NO to N₂O by nitric oxide reductase, each differing in how the two NO molecules are accommodated at the binuclear center:

  • Trans mechanism: In this model, one NO molecule binds to the heme b3 iron, and the second NO molecule binds to the non-heme FeB. This arrangement places the two NO molecules on opposite sides of the active site, facilitating N-N bond formation between them .

  • Cis-FeB mechanism: This model proposes that both NO molecules bind to the non-heme FeB center, which would require modification of the coordination sphere around FeB .

  • Cis-heme b3 mechanism: In this scenario, both NO molecules bind to the heme b3 iron, with N-N bond formation occurring at this center .

Recombinant norC can contribute to elucidating these mechanisms in several ways:

  • Electron transfer studies: By using recombinant NorC* as a defined electron input module, researchers can study the electron transfer kinetics to the catalytic center and how this affects NO reduction. This helps understand the coupling between electron transfer and catalysis .

  • Site-directed mutagenesis: With a recombinant system, researchers can introduce specific mutations in norC to alter electron transfer properties or interaction with norB. This allows systematic investigation of how these factors influence the reaction mechanism .

  • Reconstitution experiments: Purified recombinant norC can be used in reconstitution experiments with norB to study how different components and conditions affect the assembly and function of the complete NOR complex .

  • Spectroscopic analysis during catalysis: Combining recombinant norC with rapid spectroscopic techniques allows researchers to capture transient intermediates during catalysis, potentially identifying key species in the reaction mechanism .

The characterization of recombinant NOR has shown that while it exhibits the same spectroscopic properties and reactivity to NO and O₂ as native NOR, its enzymatic activity toward NO is considerably decreased. This observation itself provides insights into factors affecting the catalytic mechanism and highlights the complexity of the reaction .

How does the redox potential of recombinant norC compare to native norC, and what implications does this have?

Studies have revealed that the redox potential of recombinant NorC* (the soluble domain) is shifted by approximately 40 mV in the negative direction compared to native NorC . This significant difference has several important implications for both fundamental understanding and experimental applications:

  • Structural influence on electronic properties: The observed shift in redox potential demonstrates that the N-terminal region and/or membrane association influences the electronic properties of the heme c center in NorC. This finding contributes to our understanding of how protein structure modulates cofactor properties in metalloproteins .

  • Electron transfer kinetics: The lower (more negative) redox potential of NorC* means it is thermodynamically more difficult to oxidize compared to native NorC. This could potentially affect the rate of electron transfer from NorC to NorB in reconstituted systems, possibly contributing to the observed decrease in enzymatic activity of recombinant NOR .

  • Physiological relevance: The redox potential difference suggests that membrane association plays a role in fine-tuning the electron transfer properties of NorC to match its physiological electron donors and acceptors. In the native environment, this optimization may be critical for efficient energy conservation during denitrification .

  • Experimental considerations: When using recombinant NorC* for electrochemical studies or as part of reconstituted systems, researchers must account for this altered redox potential when interpreting results or designing experiments .

  • Structure-function relationships: The change in redox potential provides an experimental handle for investigating how specific structural elements influence the functional properties of NorC, potentially guiding rational design of modified versions with tailored properties .

This redox potential difference highlights the importance of considering the structural context when working with isolated domains of membrane proteins and underscores the complex interplay between protein structure and function in electron transfer proteins.

How can recombinant norC be utilized in biosensor development for NO detection?

Recombinant norC holds significant potential for development of third-generation enzymatic biosensors for nitric oxide detection, offering several advantages that researchers can exploit:

  • Direct electron transfer capabilities: NorC contains a heme c center that can participate in direct electron transfer with electrode surfaces. This enables the development of mediator-free biosensors where the redox activity of NorC in response to NO can be directly monitored electrochemically .

  • Specificity for NO: As a component of an enzyme that specifically reduces NO, norC-based biosensors could offer high selectivity for NO detection, addressing a critical need in biomedical and environmental monitoring applications .

  • Integration with electrode materials: Research has demonstrated that heme proteins can be successfully immobilized on various electrode materials including pyrolytic graphite edge (PGE) electrodes. NorC can be immobilized through methods such as physical adsorption, entrapment in polymers, or covalent attachment, preserving its functional properties .

  • Enhanced sensitivity through protein engineering: With a recombinant system, researchers can introduce specific modifications to norC to enhance its stability, electrode interaction, or electron transfer properties, potentially improving biosensor performance .

  • Multi-component biosensors: By incorporating both norC and norB components, it may be possible to develop biosensors that utilize the complete catalytic cycle of NO reduction, potentially offering improved sensitivity or different detection mechanisms .

Electrochemical characterization has shown that NOR exhibits distinct redox behaviors that can be monitored using techniques such as cyclic voltammetry and square-wave voltammetry. For example, square-wave voltammetry at frequencies of 20-150 Hz can resolve the different redox centers in NOR, including the heme c center of norC .

The development of such biosensors addresses a critical need, as NO is an important signaling molecule in humans that plays multiple physiological roles, but when produced in excess, can contribute to various pathologies. Therefore, sensitive and specific detection methods for NO are highly valuable for both research and clinical applications .

What approaches can be used to study the electron transfer pathway in recombinant norC?

Multiple complementary approaches can be employed to investigate the electron transfer pathway in recombinant norC, providing insights into both the kinetics and mechanisms of this process:

  • Direct electrochemistry: By immobilizing recombinant norC on electrode surfaces, researchers can study direct electron transfer between the electrode and the heme c center. Techniques such as cyclic voltammetry and square-wave voltammetry can provide information about the redox potential, electron transfer rate constant (ks), and surface concentration of electroactive species (τ*) .

  • Stopped-flow spectroscopy: This technique allows measurement of the kinetics of electron transfer between norC and physiological electron donors (such as periplasmic cytochrome c) or artificial electron donors. By monitoring absorbance changes associated with the oxidation/reduction of the heme c center over millisecond timescales, researchers can determine electron transfer rates under various conditions .

  • Site-directed mutagenesis: By introducing specific mutations at residues potentially involved in electron transfer pathways, researchers can probe the importance of individual amino acids. Comparing electron transfer kinetics between wild-type and mutant norC variants can identify critical residues .

  • Redox potential measurements: Determining the redox potential of norC under various conditions provides thermodynamic information about the electron transfer process. The observed 40 mV negative shift in recombinant norC* compared to native norC indicates how structural context influences the energetics of electron transfer .

  • Spectropotentiometric titrations: This technique combines spectroscopic monitoring with controlled potential changes, allowing researchers to observe the redox transitions of specific cofactors within norC and correlate them with applied potentials .

  • Interaction studies with electron donors: Investigating the interaction between recombinant norC and its physiological electron donors through techniques such as isothermal titration calorimetry or surface plasmon resonance can provide insights into the molecular recognition events that precede electron transfer .

  • Computational modeling: Molecular dynamics simulations and quantum mechanical calculations can complement experimental approaches by predicting electron transfer pathways, identifying key residues, and estimating electron transfer rates based on parameters such as distance, medium, and redox potential differences .

These approaches collectively enable a comprehensive understanding of how electrons flow from donors to the heme c center in norC and subsequently to the catalytic center in norB, a process fundamental to the function of nitric oxide reductase.

What are the key considerations for designing site-directed mutagenesis experiments with recombinant norC?

Site-directed mutagenesis of recombinant norC offers powerful opportunities to investigate structure-function relationships, but requires careful experimental design considering several key factors:

  • Selection of target residues:

    • Residues coordinating the heme c center: The heme iron in norC is typically coordinated by two conserved histidine and methionine residues. Mutations of these residues can reveal their role in modulating heme redox properties .

    • Residues in the proposed electron transfer pathway: Amino acids potentially involved in electron transfer between the heme c center and other components should be prioritized based on structural data or sequence conservation .

    • Residues at the interface with norB: Mutations in the region interacting with norB can help understand subunit interactions and their role in regulating electron transfer to the catalytic center .

    • Conserved residues identified through sequence alignment: Highly conserved residues across different species often play critical functional roles and are prime candidates for mutagenesis .

  • Types of mutations to consider:

    • Conservative substitutions: Replacing amino acids with others of similar properties to maintain structural integrity while subtly altering function.

    • Charge-altering mutations: Changing charged residues to neutral ones or vice versa to investigate electrostatic contributions to electron transfer.

    • Redox-active amino acid substitutions: Replacing residues like tyrosine or tryptophan that could participate in electron transfer with redox-inactive alternatives.

  • Expression and functional assessment challenges:

    • Potential impacts on protein folding: Mutations might affect proper folding of norC, requiring careful verification of structural integrity through spectroscopic methods .

    • Effects on heme incorporation: Some mutations might interfere with proper incorporation of the heme c cofactor, necessitating spectroscopic confirmation of heme presence and coordination .

    • Assessment of electron transfer capabilities: Comparing electron transfer properties between wild-type and mutant norC variants through electrochemical or spectroscopic methods is essential for functional characterization .

  • Complementary approaches:

    • Combining mutagenesis with spectroscopic analysis: Techniques like UV-visible, resonance Raman, or EPR spectroscopy can reveal how mutations affect the electronic structure of the heme center .

    • Electrochemical characterization: Determining how mutations affect redox potential and electron transfer kinetics provides direct insight into functional impacts .

    • Structural analysis when possible: If available, techniques like X-ray crystallography or NMR can reveal how mutations alter local protein structure around the heme center .

Well-designed mutagenesis experiments enable researchers to systematically map the functional landscape of norC, identifying key residues and structural elements essential for its role in the nitric oxide reduction pathway.

What are the most promising future research directions for recombinant norC studies?

The successful heterologous expression of H. halodenitrificans norC and the complete NOR complex opens several promising avenues for future research that could advance both fundamental understanding and practical applications:

  • Structural biology approaches: While significant progress has been made in characterizing norC functionally, high-resolution structural studies of H. halodenitrificans NOR remain limited. Leveraging recombinant expression systems to produce protein for crystallography, cryo-electron microscopy, or NMR studies could provide detailed structural insights, particularly into the interaction between norC and norB .

  • Mechanism elucidation through intermediate trapping: The reaction mechanism of NO reduction remains debated. Using recombinant NOR in combination with rapid-freezing techniques and advanced spectroscopy could allow capture and characterization of catalytic intermediates, helping resolve the mechanistic debate between trans, cis-FeB, and cis-heme b3 models .

  • Protein engineering for enhanced properties: The recombinant system provides a platform for rational design or directed evolution approaches to create norC variants with improved stability, altered substrate specificity, or enhanced electron transfer properties. These engineered variants could have value for both mechanistic studies and biotechnological applications .

  • Development of improved biosensors: Building on the potential of norC for NO detection, research could focus on optimizing the integration of recombinant norC with various electrode materials and detection systems to create highly sensitive and selective NO biosensors for biomedical or environmental applications .

  • Comparative studies across NOR families: Extending the recombinant expression approach to NORs from different organisms and different classes (cNOR, qNOR, CuANOR) would enable systematic comparative studies to understand evolutionary relationships and functional adaptations .

  • Understanding the decreased activity phenomenon: The observation that recombinant NOR shows decreased enzymatic activity toward NO compared to native NOR, despite similar spectroscopic properties, represents an intriguing puzzle. Investigating the molecular basis of this activity difference could reveal important insights about factors critical for optimal NOR function .

  • Integration with synthetic biology approaches: Recombinant norC could be incorporated into engineered cellular systems aimed at applications such as controlled NO production/consumption, denitrification enhancement for wastewater treatment, or development of model systems for studying NO signaling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.