Recombinant Haloquadratum walsbyi Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Haloquadratum walsbyi Protein Translocase Subunit SecD (secD) is a genetically engineered version of the SecD protein, a critical component of the Sec translocase complex responsible for protein secretion across cellular membranes in archaea. This system facilitates the translocation of unfolded proteins through the cytoplasmic membrane, a process essential for cellular function and survival in extreme environments .

Functional Domains

The protein contains conserved domains critical for its role in the Sec translocase machinery, including regions involved in ATP hydrolysis and interaction with other subunits (SecY, SecF) .

Applications

  • SDS-PAGE Analysis: Primary application for protein characterization .

  • Structural Studies: Used in crystallography and cryo-EM to map Sec translocase mechanisms .

Role in Halomucin Secretion

SecD is implicated in the translocation of halomucin, a 9,159-amino-acid glycoprotein critical for H. walsbyi’s survival in hypersaline environments. The Sec translocase expends ~183 ATP molecules to transport a single halomucin molecule, requiring 34 minutes for full translocation .

Comparative Analysis with Haloferax volcanii SecD

A homolog from Haloferax volcanii (UniProt ID: D4GTK5) shares 47% sequence identity with H. walsbyi SecD but lacks two extracellular loops implicated in substrate recognition .

FeatureH. walsbyi SecDH. volcanii SecD
Length520 aa524 aa
Transmembrane Helices1211
ATP-Binding MotifConservedPartially divergent

Genomic Stability

The secD gene resides in a conserved genomic region across H. walsbyi strains, with limited divergence (<2% in global populations) . This conservation underscores its essential role in extremophile adaptation.

Metagenomic Insights

Metatranscriptomic data from hypersaline environments (e.g., Lake Urmia) show high expression of secD homologs, correlating with osmotic stress response .

Challenges and Future Directions

  • Functional Complexity: The SecD mechanism in archaea remains less characterized than bacterial homologs, necessitating further structural studies .

  • Biotechnological Potential: Engineered SecD variants could optimize protein secretion in industrial halophile-based systems .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we have in stock, if you have specific requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it according to your requirements.
Synonyms
secD; HQ_3097A; Protein-export membrane protein SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-520
Protein Length
full length protein
Species
Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Target Names
secD
Target Protein Sequence
MIDFRENWRIILLVIVVIVSLFALVSPTLASGPDSNSAVVQQSSQTNLQYGLELAGGTRV RAPLVGVTAEEVEFEPANAREVEQRIATAIDGAGPADVIARPVTETTGTVEVTVEGVSTT ELQSILESTGYTASTVRTGVTETTRQEVVRILENKINEAGLSGGTVQEVTTAGGGHFILI EVPNEDAASVRSLVSERGTVVVQAHYPQDDIYTQQTVLQQDNFQSIGSAQEGQSGGAYVP VTVRESAANEFQQATVDTTLARPGGTRCTYSRDQNSTEPCLLLVVNGEVTNSFGMAPRLA DSLRGGSWAQDPVFQLQTANVSEAQEVAINLRAGALPAKLDLTGDDGGTTSFISPSQGEN FRTDSLLAGLVAVFAVSGVVFLRYRDARVALPMIVTALSEVLILLGFAAGIGYPLDLSVI AGFITVIGTGVDDLVIIADEVLAEGGVSSRRVFQSRFRRAFWVIGAAAATTIIAMSPLAI LSLGDLQGFAIFTILGVLVGVLITRPAYGDILRALTTGNL
Uniprot No.

Target Background

Function
This protein is involved in protein export.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haloquadratum walsbyi and why is it significant in microbiological research?

Haloquadratum walsbyi is a square-shaped haloarchaeon that commonly dominates the microbial flora of hypersaline waters such as salt lakes and saltern crystallizer ponds. This organism exhibits several remarkable characteristics that make it significant for research. Its cells are extremely fragile squares requiring greater than 14% (w/v) salt for growth, and it can represent 80% or more of the microbial population in hypersaline environments .

The organism thrives at saturating salt concentrations and can tolerate molar concentrations of Mg²⁺, making it one of a limited number of organisms able to cope with extremely low water activity. It actually achieves higher cell densities in media with >1 M MgCl₂ . The genome has a G+C content of 48%, considerably lower than all other known species of the family Halobacteriaceae, which typically have values of 61-70% .

These unique properties make Haloquadratum walsbyi an excellent model organism for studying adaptation to extreme environments and understanding the molecular mechanisms that enable life under such conditions.

What is the Protein translocase subunit SecD and what role does it play in Haloquadratum walsbyi?

The Protein translocase subunit SecD is a component of the Sec protein secretion pathway, which is essential for membrane protein insertion and secretion of proteins across membranes. In Haloquadratum walsbyi, the SecD protein (secD gene product) consists of 520 amino acids as indicated by the complete amino acid sequence available .

The SecD protein functions as part of the SecYEG-SecDF-YajC complex, which forms a channel across the membrane and facilitates the translocation of proteins. SecD, specifically, is believed to be involved in the later stages of protein translocation, potentially contributing to the release of proteins from the translocation channel and helping maintain the proton motive force needed for protein secretion.

Given the extreme environmental conditions in which Haloquadratum walsbyi thrives, its SecD protein likely has adaptations that enable it to function optimally in high salt concentrations. These adaptations could include specific amino acid compositions that maintain protein stability and function in hypersaline conditions.

How conserved is the SecD protein across different strains of Haloquadratum walsbyi?

A comparative genomic study between two Haloquadratum walsbyi isolates recovered from geographically distant sites showed that 84% of each genome sequence was highly similar to the other (98.6% identity), comprising the core sequence. Importantly, the ORFs of this shared sequence were completely syntenic (conserved in genomic orientation and order), without inversion or rearrangement .

Given this high degree of genomic conservation and synteny, it is reasonable to infer that essential proteins involved in core cellular processes, such as the SecD protein translocase subunit, would be highly conserved across different strains of Haloquadratum walsbyi. This conservation would be particularly likely for proteins involved in fundamental cellular processes like protein secretion.

What are the optimal storage and handling conditions for Recombinant Haloquadratum walsbyi Protein translocase subunit SecD?

According to the product information, the Recombinant Haloquadratum walsbyi Protein translocase subunit SecD should be stored in specific conditions to maintain its integrity and function:

  • Storage temperature: Store at -20°C; for extended storage, conserve at -20°C or -80°C

  • Buffer composition: Tris-based buffer with 50% glycerol, specifically optimized for this protein

  • Handling recommendations: Repeated freezing and thawing is not recommended

  • Working aliquots: Store at 4°C for up to one week

These conditions are designed to preserve protein stability and prevent degradation. The high glycerol content (50%) acts as a cryoprotectant, preventing ice crystal formation during freezing that could denature the protein. The Tris-based buffer maintains optimal pH for protein stability.

What methods are appropriate for studying gene expression of SecD in Haloquadratum walsbyi?

Based on methodologies described in the research on Haloquadratum walsbyi gene expression, several approaches can be applied specifically to study SecD expression:

  • RNA extraction and cDNA synthesis:

    • Extract total RNA from cultured cells or environmental samples

    • Synthesize cDNA using methods similar to those described in search result :

      • Use random hexamer primers

      • Include RNase inhibitor during first-strand synthesis

      • Employ reverse transcriptase followed by second-strand synthesis with E. coli Polymerase I, DNA Ligase, and RNase H

      • Purify double-stranded cDNA using appropriate cleanup kits

  • Next-generation sequencing:

    • Sequence cDNA using Illumina technology (such as HiSeq2000 with 100 cycles per run)

    • Perform paired-end sequencing for better coverage and assembly

  • Data analysis:

    • Align reads to reference genome (such as Hqr. walsbyi HBSQ001)

    • Count and normalize reads to give TPM (transcripts per million) values

    • Use tools like edge-pro for alignment and GhostKOALA:KEGG for functional annotation

These methods would allow researchers to quantify SecD expression under different experimental conditions or in environmental samples, providing insights into its regulation and role in the organism's physiology.

How should researchers design experiments comparing SecD expression between natural and laboratory conditions?

When designing experiments to compare SecD expression between natural environments and laboratory cultures, researchers should consider several key factors based on previous studies:

  • Sampling strategy:

    • Collect environmental samples from hypersaline environments at different seasons (like the winter/summer comparison in search result )

    • Consider temporal variation, as significant differential expression was observed between seasons

    • Include multiple sampling sites to account for geographical variation

  • Culture conditions:

    • Maintain laboratory cultures in conditions that mimic natural environments

    • Consider using media with >1 M MgCl₂ as Hqr. walsbyi achieves higher cell densities in such conditions

    • Establish multiple culture conditions to compare with natural samples

  • Controls and variables:

    • Use reference strains like HBSQ001 or C23ᵀ as controls

    • Consider the high degree of genomic conservation (84% of genome with 98.6% identity) when interpreting strain differences

    • Account for strain-specific insertions/deletions that might affect regulation

  • Data analysis considerations:

    • Be aware that expression patterns from cultivation conditions cannot be directly extrapolated to natural conditions

    • Natural populations consist of multiple ecotypes adapted to heterogeneous environmental conditions

    • Compare expression patterns across conditions using normalized metrics (TPM)

    • Validate findings with RT-qPCR for specific genes of interest

This approach acknowledges the significant differences observed between natural and cultured Haloquadratum walsbyi gene expression patterns, which likely reflect adaptation to homogeneous growth conditions in culture versus heterogeneous environmental conditions in nature .

How do genomic features of Haloquadratum walsbyi potentially impact SecD function and expression?

Several genomic features of Haloquadratum walsbyi could influence SecD function and expression:

  • Genomic islands and strain-specific variations:

    • The comparison of genomic and metagenomic sequences revealed both highly conserved and hypervariable regions, denoted as 'genomic islands'

    • These variable sequences represent a pool of genes shared by some members of the population (the pan-genome)

    • If the SecD gene is located near or within such variable regions, its expression and function could vary across the population

  • Low gene density and pseudogenes:

    • Both studied strains (C23ᵀ and HBSQ001) have relatively low gene density (79%) and over 300 pseudogenes each

    • This genomic landscape may affect the regulation of genes including SecD

    • The presence of degraded transposases suggests genome plasticity that could influence gene expression patterns

  • Mobile genetic elements:

    • Numerous types of mobile genetic elements occur in both studied strains, most of which appear to be active

    • These elements could potentially affect the expression of genes including SecD through insertional effects or regulatory changes

  • Tetra-nucleotide frequency biases:

    • Analyses show that sequences CTAG, GGCC, and AGCT are strongly avoided on the main chromosome

    • Such sequence biases may affect codon usage and gene expression efficiency for the SecD gene

    • These biases would need to be considered when designing expression systems for recombinant SecD

These genomic features provide important context for understanding potential variations in SecD function and expression across different Haloquadratum walsbyi populations and strains.

What challenges might researchers face when working with recombinant proteins from extremophiles like Haloquadratum walsbyi?

Researchers working with recombinant proteins from Haloquadratum walsbyi face several unique challenges:

  • Halophilic adaptation requirements:

    • Haloquadratum walsbyi requires at least 14% (w/v) salt for growth

    • Its proteins, including SecD, are likely adapted to function in high salt environments

    • Maintaining proper folding and function may require special buffer conditions with high salt concentrations

  • Expression system limitations:

    • Standard expression systems (E. coli, yeast) may not correctly fold halophilic proteins

    • Codon optimization may be necessary due to the unusually low G+C content (48%) compared to other haloarchaea (61-70%)

    • Post-translational modifications specific to haloarchaea may be absent in common expression hosts

  • Purification complexities:

    • High salt requirements complicate typical protein purification protocols

    • Membrane proteins like SecD present additional challenges due to hydrophobicity

    • Maintaining protein stability during purification requires specialized approaches

  • Functional assay development:

    • Standard assays may not work under the extreme conditions required by halophilic proteins

    • Developing meaningful functional assays for SecD would require reconstituting aspects of the protein translocation machinery

    • Assays must account for the protein's adaptation to high salt environments

  • Structural analysis difficulties:

    • Halophilic proteins often have unique surface charge distributions to maintain solubility in high salt

    • These adaptations can complicate crystallization and structure determination

    • NMR studies may be affected by the need for high salt concentrations

These challenges necessitate specialized approaches when working with recombinant proteins from extreme halophiles like Haloquadratum walsbyi.

How might seasonal variations affect the expression and function of SecD in natural Haloquadratum walsbyi populations?

The search results provide evidence of significant seasonal variation in gene expression patterns of natural Haloquadratum walsbyi populations that could potentially affect SecD:

  • Differential gene expression between seasons:

    • 195 significantly differentially expressed genes were identified between winter and summer samples

    • 140 genes showed higher expression in winter, mainly encoding proteins involved in energy and carbon source acquisition processes and stress responses

    • These seasonal patterns might extend to SecD expression, particularly if protein translocation is affected by seasonal stressors

  • Community composition changes:

    • The winter sample showed a different microbial community composition compared to summer

    • Haloquadratum dominated in both seasons but decreased from 55% (summer) to 47% (winter) of total expressed rRNA genes

    • Other genera showed more dramatic seasonal changes, with Haloarcula decreasing 5-fold and Salinibacter increasing from 7% to 16%

    • These community shifts could affect selective pressures on protein secretion systems

  • Adaptation to environmental stressors:

    • Winter conditions likely present different stressors than summer (temperature, light intensity, nutrient availability)

    • SecD function in protein translocation may be differentially regulated to respond to these seasonal challenges

    • The higher expression of stress response genes in winter suggests potential seasonal regulation of cellular machinery including protein secretion systems

  • Metabolic adjustments:

    • Genes involved in energy and carbon source acquisition showed higher expression in winter

    • These metabolic shifts may correspond with changes in membrane protein composition

    • SecD function in facilitating membrane protein insertion could be seasonally regulated to accommodate these metabolic adaptations

This seasonal variation highlights the importance of temporal sampling when studying natural populations and suggests that SecD expression and function may be subject to environmental regulation that is not observed under constant laboratory conditions.

How should researchers interpret differences in SecD expression between laboratory and natural conditions?

Based on the findings regarding gene expression differences between cultured and natural Haloquadratum walsbyi, researchers should consider several principles when interpreting SecD expression data:

For example, the study found genes that were highly expressed in culture but had low expression in natural samples, including a cell surface adhesin protein (7736 TPM in culture vs. <100 TPM in nature) and genes involved in sialic acid synthesis that were only expressed in culture . Conversely, some transporters showed significantly higher expression in natural samples. Similar patterns might be observed for SecD depending on its specific role in adaptation to laboratory versus natural conditions.

What bioinformatic approaches are recommended for analyzing SecD sequence and expression data?

Based on the methodologies described in the search results, the following bioinformatic approaches are recommended for analyzing SecD sequence and expression data:

  • For sequence analysis:

    • Multiple sequence alignment tools to compare SecD sequences across strains and related species

    • Structure prediction tools to identify functional domains and potential halophilic adaptations

    • Comparative genomic approaches as used in search result to examine synteny and conservation

    • Analysis of tetra-nucleotide frequencies and codon usage patterns that might affect expression

  • For transcriptomic data analysis:

    • Read alignment using tools like edge-pro to map reads to reference genomes

    • Normalization to TPM (transcripts per million) values for cross-sample comparisons

    • Functional annotation using GhostKOALA:KEGG tools to place findings in biological context

    • Statistical analysis to identify significant differential expression between conditions

  • For metatranscriptomic applications:

    • Community composition analysis using 16S rRNA reads to provide ecological context

    • Targeted extraction of SecD-related reads from complex datasets

    • Comparison across different environmental samples and seasons

    • Table 1 shows metrics for metatranscriptomic analysis that should be reported:

MetricSummer ExampleWinter Example
Total number of reads27,765,94135,609,827
% Target organism recruited reads31%25%
% Target organism reads assigned as mRNA28% (8.7% of total)40% (10% of total)
Number of genes covered2,6142,616
Average read number per gene8841,355
Fold coverage per gene74109

These approaches would provide comprehensive insights into both the sequence characteristics and expression patterns of the SecD protein across different conditions and populations.

How can researchers validate the functional significance of observed variations in SecD sequences?

To validate whether observed variations in SecD sequences are functionally significant, researchers should employ a multi-faceted approach:

  • Computational analysis:

    • Structural modeling to predict the impact of sequence variations on protein folding and function

    • Conservation analysis across related species to identify functionally constrained regions

    • Prediction of post-translational modifications that might be affected by sequence variations

    • Analysis of codon usage and potential effects on translation efficiency

  • In vitro functional assays:

    • Heterologous expression of variant SecD proteins

    • Reconstitution of minimal translocation systems with variant SecD proteins

    • ATPase activity assays to measure energetic coupling

    • Protein-protein interaction studies with other components of the Sec machinery

  • Genetic approaches:

    • Complementation studies in SecD-deficient systems

    • Site-directed mutagenesis to introduce or correct specific variations

    • Creation of chimeric proteins to identify functional domains

    • In vivo assays measuring translocation efficiency of reporter proteins

  • Ecological correlation:

    • Compare sequence variations with environmental parameters

    • Analyze whether specific variants correlate with particular ecological niches

    • Examine seasonal distribution of variants in natural populations

    • Consider the genomic context of variations, particularly in light of the syntenic nature of core Haloquadratum walsbyi genomes

This integrated approach would provide strong evidence for the functional significance of observed variations in SecD sequences and contribute to understanding how this protein adapts to extreme environments and different ecological conditions.

What are promising research directions for understanding the role of SecD in Haloquadratum walsbyi's adaptation to extreme environments?

Several promising research directions could advance our understanding of SecD's role in Haloquadratum walsbyi's adaptation to extreme environments:

  • Comparative analysis across salinity gradients:

    • Study SecD sequence and expression in Haloquadratum walsbyi populations from environments with different salt concentrations

    • Compare with SecD from related haloarchaea with different salt tolerances

    • Identify specific adaptations in SecD that correlate with extreme halophilicity

  • Structural biology approaches:

    • Determine the three-dimensional structure of Haloquadratum walsbyi SecD

    • Compare with structures from non-halophilic organisms

    • Identify structural adaptations that facilitate function in high salt environments

    • Examine how the amino acid sequence (provided in search result ) contributes to halophilic adaptation

  • Systems biology integration:

    • Study SecD in the context of the complete protein secretion network

    • Examine co-expression patterns with other components of the Sec machinery

    • Identify regulatory networks controlling SecD expression under different environmental conditions

    • Apply findings from the differential expression studies to understand SecD regulation

  • Experimental evolution:

    • Subject Haloquadratum walsbyi to changing salt concentrations over many generations

    • Monitor changes in SecD sequence and expression

    • Identify adaptive mutations that affect protein translocation efficiency

    • Consider the remarkable global distribution and conservation of Haloquadratum walsbyi in interpreting results

These research directions would provide valuable insights into how fundamental cellular processes like protein translocation have adapted to function in extreme environments, contributing to our broader understanding of the limits of life.

How might emerging technologies advance our understanding of SecD function in Haloquadratum walsbyi?

Emerging technologies offer exciting opportunities to deepen our understanding of SecD function in Haloquadratum walsbyi:

  • Cryo-electron microscopy (cryo-EM):

    • Visualize the SecD protein in the context of the complete Sec translocon

    • Capture different conformational states during the translocation process

    • Reveal how halophilic adaptations affect protein structure and dynamics

    • Overcome challenges of crystallizing membrane proteins from extremophiles

  • Single-molecule techniques:

    • Measure the kinetics and forces involved in protein translocation

    • Directly observe the contribution of SecD to the translocation process

    • Compare efficiency under different salt concentrations

    • Identify rate-limiting steps in halophilic protein translocation

  • Advanced genomic and transcriptomic approaches:

    • Single-cell transcriptomics to capture cell-to-cell variation in SecD expression

    • Long-read sequencing to better resolve genomic context and structural variations

    • Ribosome profiling to examine translational regulation of SecD

    • CRISPR-based approaches for genetic manipulation of Haloquadratum walsbyi

  • Computational approaches:

    • Molecular dynamics simulations of SecD in high-salt environments

    • Machine learning to predict functional consequences of sequence variations

    • Systems modeling of the complete protein secretion pathway

    • Integration of multi-omics data to place SecD function in broader cellular context

These technologies could overcome current limitations in studying extremophile proteins and provide unprecedented insights into how fundamental cellular machinery like the Sec translocon functions in extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.