Recombinant Haloquadratum walsbyi Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Haloquadratum walsbyi SecF

SecF is a core subunit of the Sec translocase complex, which facilitates the transport of unfolded polypeptides across cellular membranes. In H. walsbyi, this system is essential for secreting large proteins like halomucin, a 9,159-amino-acid glycoprotein critical for extracellular protection in hypersaline environments . Recombinant SecF allows researchers to study this archaeal secretion mechanism under controlled conditions.

Functional Role in Protein Translocation

  • Mechanism: The SecFYEG complex forms a channel for post-translational translocation of unfolded proteins. SecF stabilizes the SecY-SecE core and assists in coordinating ATP hydrolysis during substrate movement .

  • Halomucin Secretion: SecF is implicated in secreting halomucin, a massive protein requiring ~34 minutes and 183 ATP molecules for translocation . This underscores SecF’s role in managing energetically costly secretory processes.

  • Genomic Conservation: Despite global distribution, H. walsbyi strains show remarkable genome conservation (98.6% identity between isolates), suggesting SecF’s sequence and function are tightly conserved .

4.1. Secretion Studies

  • Recombinant SecF enables in vitro reconstitution of the Sec translocase to study halomucin secretion kinetics and ATP dependency .

  • Comparative studies with bacterial SecF (e.g., E. coli) highlight structural adaptations in archaeal homologs for extreme salinity .

4.2. Evolutionary Insights

  • H. walsbyi’s Sec system retains functional parallels to bacteria but operates in a low-GC genome (47.8%) with unique codon bias, influencing recombinant expression efficiency .

  • Strain-specific deletions in halomucin genes (e.g., missing CTLD domains in strain C23) correlate with SecF’s role in translocating variable substrates .

Production and Handling Notes

  • Stability: Lyophilized SecF retains activity for years at -80°C but degrades rapidly if reconstituted improperly .

  • Applications: Used in ELISA, antibody production, and membrane protein interaction assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secF; HQ_3098A; Protein-export membrane protein SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Target Names
secF
Target Protein Sequence
MAEFTVPEVDYTRYSNYQLVVIPLIILAVALLIIASWYVLTGSPVTQGIAFTGGTEITVE TDGATTTQIVEAFSVEPESVQAVPTANTYIVTFQSNGNSGVAVTDLTRQAEQAGFEVQSA YEVSPSFGATTQTLALGGVGVAFLGMSVLVFLMFRVFVPSIAVVVSAFSDIAISVALMNV LGIELSLGTVAALLMIIGYSVDSDILLNNHVLRRSGDFYESTYRAMRTGVTMTLTSIIAM SVMAAVATAFGIQLLAAIGTVLVFGLIADLMNTYLLNLSLLRWYKFKGVAR
Uniprot No.

Target Background

Function
Plays a role in protein export.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haloquadratum walsbyi and why is its SecF protein significant for research?

Haloquadratum walsbyi is an extremely halophilic archaeon that commonly dominates the microbial flora of hypersaline waters such as salt lakes and saltern crystallizer ponds. Its cells are highly distinctive, being thin squares or rectangles, usually containing gas vesicles and polyhydroxybutyrate granules. The organism requires salt concentrations of at least 14% w/v (more than 4-fold higher than seawater) for growth and can tolerate molar concentrations of Mg²⁺, making it one of a limited number of organisms able to cope with extremely low water activity .

The SecF protein is significant as it forms part of the Sec protein translocation system, which is responsible for transporting proteins across or into cell membranes. In archaea like H. walsbyi, this system is crucial for cell survival in extreme environments. Understanding SecF function provides insights into how extremophiles adapt their protein secretion machinery to function under harsh conditions.

What expression systems are most effective for producing recombinant H. walsbyi SecF protein?

When expressing halophilic proteins like H. walsbyi SecF, several specialized approaches yield better results than standard expression systems:

Table 1: Comparison of Expression Systems for Halophilic Proteins

Expression SystemAdvantagesLimitationsRecommended Modifications
Haloferax volcaniiNative-like salt conditionsSlower growth than E. coliUse inducible promoters
E. coli with salt modificationsHigher yieldPotential misfoldingAdd 1-3M KCl to lysis buffer
E. coli with fusion tagsImproved solubilityTag may interfere with functionUse cleavable MBP or SUMO tags
Cell-free systemsControl over ionic environmentHigher costSupplement with K⁺ ions

For H. walsbyi SecF specifically, the E. coli system with salt modifications has shown promise when combined with a twin-arginine signal sequence and salt-adapted folding chaperones. Adjusting the expression temperature to 18-20°C and using specialized media containing potassium rather than sodium can significantly improve protein yield and proper folding.

The codon optimization strategy should account for H. walsbyi's unusual codon preferences, which show a strong bias toward codons with A or T in the 3rd position (approximately 60% A+T vs. approximately 20% in other haloarchaea) .

What purification strategies should be implemented for H. walsbyi SecF to maintain its native structure?

Purifying membrane proteins from halophiles requires specialized approaches to maintain protein stability and native structure:

  • Buffer composition is critical - use buffers containing 2-4M KCl rather than NaCl to mimic the intracellular environment of H. walsbyi.

  • Implement a two-phase extraction process:

    • Initial solubilization with mild detergents (DDM or LDAO)

    • Secondary purification using immobilized metal affinity chromatography (IMAC)

    • Final polishing with size exclusion chromatography

  • Temperature control throughout purification should remain between 4-10°C to prevent protein aggregation.

  • Avoid rapid desalting, which causes irreversible denaturation of halophilic proteins.

For SecF specifically, researchers should maintain at least 2M KCl in all purification buffers and consider using lipid nanodiscs to stabilize the protein after extraction from the membrane. Storage should be at -20°C in Tris-based buffer with 50% glycerol for optimal stability, while extended storage should be at -20°C or -80°C .

How can functional studies of SecF be designed to elucidate its role in the Sec translocase complex under high salt conditions?

Designing functional studies for SecF in high salt conditions requires specialized approaches:

  • Reconstitution systems: Develop proteoliposomes with archaeal lipids from H. walsbyi or related haloarchaea. The lipid composition should mimic the natural membrane environment, with archaeol-based lipids maintained in 3-4M KCl solutions.

  • Transport assays: Measure protein translocation efficiency using fluorescently labeled substrate proteins. Compare translocation rates at varying salt concentrations (2M, 3M, 4M KCl) to determine salt optimum for SecF function.

  • Site-directed mutagenesis: Target conserved residues in the transmembrane domains to identify those critical for salt adaptation versus those required for basic transport function. Pay particular attention to acidic residues, which are often overrepresented in halophilic proteins.

  • Crosslinking studies: Use bifunctional crosslinkers with varying spacer lengths to map interactions between SecF and other components of the translocation system under high salt conditions.

  • In vitro translation systems: Develop a coupled translation-translocation system using salt-adapted ribosomes and purified Sec components to study the complete process.

Data analysis should account for salt-dependent changes in fluorescence, protein stability, and interaction kinetics, with appropriate controls at each salt concentration.

What considerations are important when designing comparative analyses between H. walsbyi SecF and homologs from non-halophilic organisms?

When comparing H. walsbyi SecF with homologs from non-halophilic organisms, researchers should consider:

The statistical analysis should include multivariate approaches to distinguish salt-adaptation features from general SecF conservation patterns.

What spectroscopic methods are most suitable for studying SecF structural changes in high salt environments?

Several spectroscopic methods can be adapted for high-salt conditions to study SecF:

Table 2: Spectroscopic Methods for Studying Proteins in High Salt

MethodSalt ToleranceStructural InformationAdaptations for High Salt
Circular Dichroism (CD)ModerateSecondary structureBackground subtraction with precise matching buffers
Fluorescence SpectroscopyHighTertiary structure, dynamicsUse salt-stable fluorophores (Alexa series)
FTIRVery highSecondary structureATR-FTIR with salt-corrected reference spectra
NMRLimitedAtomic resolutionDeuterated salt solutions, specialized pulse sequences
EPRHighLocal environment, distancesSite-directed spin labeling with salt-stable nitroxides

For SecF specifically, a combination of CD spectroscopy to monitor secondary structure retention and site-directed fluorescence labeling at non-conserved positions can provide valuable insights into salt-dependent conformational changes. When using tryptophan fluorescence, corrections must be made for salt-induced quenching effects.

Time-resolved FRET (Förster Resonance Energy Transfer) between strategically placed fluorophores can detect salt-dependent distance changes between domains. For membrane-embedded regions, solid-state NMR with specifically labeled amino acids represents the gold standard approach, though technically challenging.

How can researchers assess the thermodynamic parameters of SecF-mediated protein translocation in halophilic conditions?

Assessing thermodynamic parameters of SecF-mediated protein translocation requires specialized approaches for halophilic conditions:

  • Isothermal Titration Calorimetry (ITC) can be adapted for high salt by:

    • Using reference cells containing identical salt concentrations

    • Performing titrations at multiple temperatures (10-50°C) to calculate entropy and enthalpy changes

    • Correcting for salt-dependent heat capacity changes

  • Surface Plasmon Resonance (SPR) measurements should:

    • Immobilize SecF in lipid nanodiscs rather than directly on chips

    • Use running buffers with precisely matched salt concentrations

    • Include salt-concentration gradients to determine the KCl dependency of binding events

  • Differential Scanning Calorimetry (DSC) can reveal:

    • Unfolding transitions as a function of salt concentration

    • Domain stability differences in the multidomain SecF protein

    • Stabilizing effects of substrate binding

The thermodynamic data should be analyzed using models that incorporate salt as an additional parameter in the binding polynomial, accounting for both specific binding of ions and general electrostatic screening effects.

ΔG=ΔHTΔS+RTΣνiln[salt]iΔG = ΔH - TΔS + RTΣνi ln[salt]i

Where νi represents the preferential ion binding coefficients for each ion species i.

How does the genomic context of secF in H. walsbyi compare to other haloarchaea, and what does this suggest about its evolution?

The genomic context of secF in H. walsbyi provides valuable evolutionary insights:

In H. walsbyi, the secF gene is found at locus HQ3098A in strain C23T . Comparative genomic analysis shows that H. walsbyi has a highly syntenic genome between the two studied isolates (C23T and HBSQ001), with 84% of sequence being highly similar (98.6% identity) and completely conserved in genomic orientation and order, without inversions or rearrangements .

Table 3: Comparative Genomic Features of H. walsbyi Strains

FeatureH. walsbyi C23TH. walsbyi HBSQ001Implications for SecF
Chromosome size3.1 MB3.1 MBConserved genomic size
G+C content47.8%47.8%Low compared to other haloarchaea (61-70%)
Number of predicted ORFs2,8942,819Similar gene density
Pseudogenes337314Genome undergoing reductive evolution
secF locusHQ3098AConserved positionMaintained in core genome

The secF gene likely belongs to the core genome of H. walsbyi, as it is maintained with high sequence conservation between geographically distant isolates. The unique codon usage pattern in H. walsbyi, with a strong bias toward A/T in the third position compared to other haloarchaea, suggests that secF has evolved alongside the general genomic drift toward lower G+C content in this organism .

Interestingly, the tRNA pool in H. walsbyi lacks tRNAs with A in the first position of the anticodon, which would typically decode NNT codons. This means that despite a preference for NNT codons in the genome, all of these must be decoded by tRNA anticodons using G:U base-pairing , which may affect SecF translation efficiency.

What are common challenges in expressing and purifying functional SecF protein, and how can they be addressed?

Researchers face several challenges when working with H. walsbyi SecF:

Table 4: Common Challenges and Solutions for SecF Expression and Purification

ChallengeCauseSolution
Low expression yieldToxicity to host cellsUse tight induction control; C41/C43 E. coli strains
Inclusion body formationImproper folding in low saltCo-express with halophilic chaperones; add KCl to growth media
Aggregation during purificationSalt concentration changesMaintain consistent high salt throughout purification
Loss of function after purificationDelipidation during detergent stepsAdd archaeal lipid extracts to purification buffers
DegradationMembrane-associated proteasesInclude multiple protease inhibitors; perform work at 4°C
Poor reconstitutionIncompatible lipidsUse archaeal lipids or synthetic lipids with branched chains
Inconsistent activity assaysSalt effects on assay componentsDevelop salt-resistant activity assays with appropriate controls

When troubleshooting expression problems, a systematic approach comparing different constructs (varying in tag position, included domains, and signal sequences) often identifies viable candidates. For purification issues, screening multiple detergents at various concentrations while monitoring protein stability through size-exclusion chromatography profiles provides valuable optimization data.

For SecF specifically, expression as a fusion with maltose-binding protein (MBP) followed by on-column cleavage in high-salt buffers has shown promising results with other halophilic membrane proteins.

How can researchers effectively analyze SecF interactions with other components of the Sec system under halophilic conditions?

Analyzing protein-protein interactions (PPIs) in high-salt environments requires specialized approaches:

  • Co-immunoprecipitation adaptations:

    • Use antibodies validated for high-salt stability

    • Maintain at least 2M KCl in all washing steps

    • Include negative controls with scrambled peptides

  • Crosslinking strategies:

    • Choose crosslinkers stable in high salt (maleimide-based preferred)

    • Optimize crosslinker concentration to prevent non-specific aggregation

    • Use MS-cleavable crosslinkers for improved identification by mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Select fluorophore pairs with minimal salt-sensitivity

    • Calibrate distance measurements using salt-stable reference constructs

    • Account for salt-induced changes in fluorophore quantum yield

  • Surface Plasmon Resonance (SPR) adaptations:

    • Reconstitute SecF in nanodiscs for chip immobilization

    • Match running buffer precisely to sample buffer salt concentration

    • Use gradient stabilization periods 3-5× longer than standard protocols

  • Native mass spectrometry:

    • Employ specialized ionization techniques compatible with high salt

    • Use collision-induced dissociation to distinguish specific from non-specific interactions

    • Carefully control salt adduction through buffer exchange techniques

The most informative approach combines complementary methods, such as in vivo crosslinking followed by affinity purification and mass spectrometry identification, with results validated through site-directed mutagenesis of key interaction residues.

How might SecF function be investigated in the context of H. walsbyi's adaptation to extreme environments?

Investigating SecF function in the context of environmental adaptation requires integrating multiple experimental approaches:

  • Comparative expression analysis:

    • Measure secF transcript levels under varying salt concentrations (2-5M NaCl)

    • Compare expression at different growth phases and stress conditions

    • Correlate SecF abundance with translocation efficiency of specific substrates

  • In vivo translocation assays:

    • Develop reporter systems with halophilic enzymes fused to Sec-dependent signal sequences

    • Use site-directed mutations in secF to create temperature-sensitive or salt-sensitive variants

    • Measure translocation kinetics under varying environmental conditions

  • Adaptive laboratory evolution experiments:

    • Subject H. walsbyi to gradually shifting environmental parameters

    • Sequence evolved strains to identify secF mutations

    • Characterize phenotypic changes in protein secretion patterns

  • Ecological sampling and analysis:

    • Isolate H. walsbyi from environments with different salt compositions

    • Sequence secF genes to identify natural variation

    • Correlate sequence variations with environmental parameters

Such studies should examine not only how SecF functions in high salt but also how it responds to other extreme conditions often found in hypersaline environments, such as high UV radiation, temperature fluctuations, and nutrient limitation.

What is known about the relationship between SecF and halomucin secretion in H. walsbyi?

The relationship between SecF and halomucin secretion represents an intriguing area of research:

Halomucin is an extremely large secreted protein (927 kDa) produced by H. walsbyi that is believed to play a role in the organism's adaptation to its hypersaline environment. Studies have demonstrated that halomucin is indeed secreted outside the cells, and it appears to be transported in its unfolded state through the Sec pore of the membrane .

This is particularly interesting considering the enormous size of halomucin, as most secretion systems would struggle with such a large substrate. The Sec translocation system, including the SecF component, must therefore be specially adapted to handle extremely large proteins while maintaining functionality in high salt conditions.

The translocation process likely follows similar principles to those observed in the SecEYGA translocation system of Escherichia coli, where the average translocation rate is approximately 270 amino acid residues per minute with an energy expenditure of one ATP per 50 amino acids . For halomucin, with its 9,159 amino acids, this would theoretically require:

  • Approximately 34 minutes for complete translocation

  • Consumption of about 183 ATP molecules

Research into SecF's specific role in halomucin secretion would benefit from:

  • Developing conditional secF mutants to observe effects on halomucin secretion

  • Fluorescently tagging both SecF and halomucin to visualize their interaction during the secretion process

  • Biochemical characterization of SecF-halomucin interactions using purified components

Such studies would provide valuable insights into how extremophiles have adapted their protein secretion machinery to handle exceptionally large proteins in challenging environments.

What are the most promising future research directions for understanding SecF function in halophilic archaea?

Understanding SecF function in halophilic archaea presents several promising research directions:

  • Structural biology approaches:

    • Cryo-EM structures of the complete Sec translocase from H. walsbyi

    • Comparison with mesophilic archaeal and bacterial homologs

    • Time-resolved structural studies to capture conformational changes during translocation

  • Systems biology integration:

    • Proteome-wide identification of Sec-dependent substrates in H. walsbyi

    • Network analysis of secretion pathways under changing environmental conditions

    • Mathematical modeling of protein translocation processes in extremophiles

  • Synthetic biology applications:

    • Engineering hybrid Sec systems with components from different extremophiles

    • Development of halophilic cell factories with enhanced protein secretion capabilities

    • Creation of salt-stable protein production platforms for industrial applications

  • Evolutionary perspectives:

    • Ancestral sequence reconstruction of SecF in haloarchaea

    • Correlation of SecF evolution with adaptation to increasingly extreme environments

    • Horizontal gene transfer analysis across extremophilic microorganisms

These research directions would benefit from emerging technologies such as in-cell cryo-electron tomography, microfluidics-based single-cell analysis, and advanced computational approaches for modeling membrane protein dynamics in high-salt environments.

How might understanding H. walsbyi SecF contribute to broader knowledge in extremophile biology and biotechnology?

Research on H. walsbyi SecF has significant implications for both fundamental and applied science:

From a fundamental perspective, understanding how SecF functions in extreme halophiles provides insights into protein evolution and adaptation mechanisms. The study of halophilic proteins reveals how cellular machinery can be modified to function in environments that would denature most proteins. This knowledge contributes to our understanding of the limits of life and potential for extraterrestrial life in high-salt environments like those suspected on Mars or Europa.

From an applied perspective, insights from H. walsbyi SecF could lead to:

  • Enzyme engineering - Principles of salt adaptation could be applied to engineer industrial enzymes with enhanced stability in harsh conditions used in manufacturing processes.

  • Bioremediation technologies - The development of halophilic organisms with enhanced secretion capabilities for cleaning up hypersaline industrial waste.

  • Pharmaceutical applications - Novel expression systems for producing and secreting therapeutic proteins stable under extreme conditions, potentially extending shelf-life without refrigeration.

  • Synthetic biology platforms - Creation of chassis organisms capable of growing in non-standard conditions, reducing contamination risks in industrial bioprocessing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.