Recombinant Halorhodospira halophila ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant atpB is produced using heterologous expression systems, optimized for solubility and yield:

  • Expression Hosts:

    • E. coli: Default system for full-length protein with N-terminal His-tag .

    • Yeast and mammalian cells: Used for partial constructs, often requiring glycerol stabilization .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged variants), followed by buffer exchange into Tris-based formulations with 50% glycerol for storage .

  • Stability: Sensitive to freeze-thaw cycles; recommended storage at -80°C in aliquots .

Biotechnology

  • Antibody Production: Serves as an antigen for generating antibodies targeting ATP synthase complexes .

  • Environmental Adaptation Studies: Insights into osmoprotection strategies under hypersaline conditions, including KCl accumulation and glycine betaine utilization .

Key Research Findings

  • Genomic Context: The atpB gene is part of a conserved operon in H. halophila’s genome, co-expressed with other ATP synthase subunits .

  • Functional Divergence: Unlike F-type ATPases, H. halophila’s A-type ATP synthase exhibits unique chloride dependence and nitrate inhibition .

  • Adaptation Mechanisms: The recombinant subunit retains stability in high-salt buffers, mirroring the organism’s natural habitat .

Future Directions

Current research gaps include elucidating atpB’s role in coupling proton motive force to ATP synthesis under extreme salinity. Genome sequencing of H. halophila SL1 provides a roadmap for mutagenesis studies targeting conserved residues.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. If you have a specific format requirement, please specify it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Hhal_2436; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Halorhodospira halophila (strain DSM 244 / SL1) (Ectothiorhodospira halophila (strain DSM 244 / SL1))
Target Names
atpB
Target Protein Sequence
MSADSEFDATDYIQHHLTNLRLDLTEGTIDSEATGFWTLHIDTLIMSFGLGALFCYVFWL AARQATPGVPGGLQNFVEAMIEFIDKTVKETFHAKSKVIAPLALTIFCWVFLSNLMDLVP IDMVPSIMMAVGVDYWKILPSVDLNFTFGLSLSVLALIIIYGVMGQGVGGWLKSWVTHPL GPWLAPANLILNIVEFIAKPVSLSLRLFGNLYAAELVFILISLLPWWIQWALGTPWAIFH ILVVPLQAFIFMMLTVVYLAMAYEEH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit a (atpB) in Halorhodospira halophila and how does it differ from other bacterial ATP synthases?

The ATP synthase subunit a (atpB) in Halorhodospira halophila is a critical component of the F-type ATP synthase complex that catalyzes ATP synthesis through chemiosmotic coupling of proton transport. Unlike the A-type ATP synthases found in archaeal extremophiles such as Halobacterium salinarium, H. halophila possesses an F-type ATP synthase characteristic of bacteria and eukaryotic mitochondria . The key distinction lies in the structural organization and evolutionary relationship, as A-type ATP synthases share greater sequence identity with eukaryotic vacuolar ATPases (>50%), while F-type ATP synthases show less than 30% sequence identity when compared to A-type ATPases .

What expression systems are most effective for producing recombinant H. halophila ATP synthase subunit a?

For expressing recombinant H. halophila ATP synthase subunit a, E. coli-based expression systems modified for halophilic proteins are most commonly employed. When using standard expression systems, researchers should consider:

  • Codon optimization for the expression host

  • Using salt-tolerant E. coli strains

  • Adding stabilizing agents to buffer solutions

  • Expression at lower temperatures (16-25°C) to improve protein folding

  • Using fusion tags (such as His6, MBP, or SUMO) to enhance solubility

Unlike archaeal halophilic proteins that may require high salt conditions for proper folding, H. halophila proteins generally exhibit moderate halophilicity, making them more amenable to standard recombinant protein expression approaches with appropriate modifications .

How does membrane potential influence ATP synthesis by H. halophila ATP synthase?

Membrane potential plays a crucial role in driving ATP synthesis in H. halophila. Research on related halophilic organisms demonstrates that a threshold membrane potential of approximately -100 mV (inside-negative) is required for ATP synthesis . This potential can be generated through light-driven ion pumps or through pH gradients. The synthesis is optimized at specific intracellular pH conditions, with maximal activity typically observed in the range of pH 6.5, which differs from the optimal pH of around 8 for many other F-type ATPases . This relationship between membrane potential and ATP synthesis follows the chemiosmotic principles but with adaptations specific to the halophilic environment.

What structural adaptations does H. halophila ATP synthase subunit a exhibit for function in high-salt environments?

H. halophila ATP synthase subunit a exhibits several structural adaptations for functionality in high-salt environments:

  • Increased proportion of acidic amino acids (aspartate and glutamate) on the protein surface

  • Reduced hydrophobic core compared to non-halophilic homologs

  • Specific ion-binding sites that contribute to protein stability

  • Modified protein-protein interaction interfaces within the ATP synthase complex

These adaptations help maintain proper protein folding and function in high ionic strength conditions while preserving the core mechanistic features necessary for proton translocation and ATP synthesis . Unlike archaeal halophiles that may require molar concentrations of salt for stability, H. halophila proteins typically exhibit activity across a broader range of salt concentrations.

How can researchers distinguish between ATP synthase activity and ATP hydrolysis in experimental systems using recombinant H. halophila subunits?

Distinguishing between ATP synthase and ATP hydrolysis activities requires careful experimental design:

  • Membrane Vesicle Orientation: Prepare inside-out vesicles where the ATP synthase F1 domain faces outward for ATP synthesis measurements

  • Controlled Energization:

    • For synthesis: Establish proton gradients using light-activated systems or pH shifts

    • For hydrolysis: Supply ATP in the absence of a proton gradient

  • Specific Inhibitors:

    • Use N,N'-dicyclohexylcarbodiimide (DCCD) at concentrations around 25 μM/2 mg protein/ml to inhibit both activities

    • Employ oligomycin as a more specific inhibitor of F-type ATP synthases

  • Real-time Measurements:

    • For synthesis: Luciferin-luciferase assay to detect ATP production

    • For hydrolysis: Coupled enzyme assays to measure phosphate release or NADH oxidation

  • pH and Membrane Potential Control:

    • Maintain precise control of pH (optimum ~6.5 for synthesis)

    • Measure membrane potential using voltage-sensitive dyes concurrently

These approaches enable researchers to quantify directional activities and determine the factors that regulate the balance between synthesis and hydrolysis .

What evolutionary insights can be gained from comparative analysis of H. halophila ATP synthase with archaeal ATP synthases?

Comparative analysis between H. halophila ATP synthase (F-type) and archaeal ATP synthases (A-type) provides significant evolutionary insights:

  • Despite inhabiting similar extreme environments, these enzymes represent distinct evolutionary lineages, with archaeal ATP synthases showing greater homology to eukaryotic vacuolar ATPases than to bacterial F-type ATP synthases

  • Sequence analysis reveals that while F-type ATP synthases (like H. halophila's) share less than 30% identity with archaeal A-type ATPases, key catalytic residues are conserved, suggesting convergent evolution of mechanistic features

  • Phylogenetic analysis places H. halophila ATP synthase closer to other bacterial enzymes, while archaeal ATP synthases cluster with eukaryotic V-type ATPases, supporting the three-domain view of life

  • The adaptation to high salt environments represents a case of parallel evolution, where similar functional adaptations evolved independently in Bacteria and Archaea

  • Subunit composition and stoichiometry differences between these systems reflect distinct evolutionary trajectories despite similar environmental pressures

These comparative analyses help reconstruct the evolutionary history of ATP synthases and provide insights into the molecular adaptations enabling energy conversion in extreme environments .

What are the optimal conditions for purifying recombinant H. halophila ATP synthase subunit a?

The purification of recombinant H. halophila ATP synthase subunit a requires specific conditions to maintain structural integrity and function:

Purification Protocol:

  • Cell Lysis:

    • Buffer: 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 5% glycerol

    • Add protease inhibitors (PMSF, leupeptin, pepstatin)

    • Gentle lysis via sonication (10-15 short pulses) to prevent protein aggregation

  • Membrane Fraction Isolation:

    • Centrifuge lysate at 20,000g for 30 minutes to remove cell debris

    • Ultracentrifuge supernatant at 150,000g for 1 hour to collect membrane fraction

    • Resuspend membrane pellet in solubilization buffer

  • Protein Solubilization:

    • Use mild detergents: n-dodecyl-β-D-maltoside (DDM, 1-2%) or digitonin (1%)

    • Include stabilizing agents: 10-15% glycerol and 100-300 mM NaCl

    • Gentle stirring at 4°C for 1-2 hours

  • Affinity Chromatography:

    • For His-tagged constructs: Ni-NTA with 10-20 mM imidazole in wash buffer

    • Low imidazole (5-10 mM) in binding buffer to reduce non-specific binding

    • Elution with 250-300 mM imidazole gradient

  • Size Exclusion Chromatography:

    • Superdex 200 column equilibrated with 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM

    • Flow rate: 0.5 ml/min to maintain protein integrity

This optimized protocol typically yields protein with >90% purity suitable for structural and functional studies .

How can researchers effectively measure ATP synthase activity in reconstituted H. halophila membrane vesicles?

Measuring ATP synthase activity in reconstituted H. halophila membrane vesicles requires establishing appropriate proton gradients and detection systems:

Protocol for Activity Measurement:

  • Vesicle Preparation:

    • Reconstitute purified ATP synthase into liposomes (protein:lipid ratio of 1:50-1:100)

    • Use E. coli polar lipids or synthetic lipids (POPC:POPE:cardiolipin, 7:2:1)

    • Prepare vesicles by detergent dialysis or extrusion through 400 nm filters

  • Establishment of Proton Gradient:

    • Light-Driven Method: Incorporate light-activated proton pumps

    • pH-Jump Method: Create pH differential by acidification of external medium

      • Base condition: pH 8.0 internal, pH 8.0 external

      • Acid transition: Shift external pH to 6.0-6.4 (ΔpH ≥ 1.6 units)

  • ATP Synthesis Measurement:

    • Luciferin-Luciferase Assay:

      • Add 0.1 mM ADP, 10 mM Pi, 2.5 mM MgCl₂

      • Include luciferin-luciferase reagent for real-time ATP detection

      • Measure luminescence continuously during gradient establishment

  • Membrane Potential Monitoring:

    • Use voltage-sensitive fluorescent dyes (e.g., Oxonol VI)

    • Calibrate using K⁺/valinomycin to establish known potentials

    • Threshold potential for ATP synthesis is approximately -100 mV

  • Controls and Validation:

    • Include DCCD (25 μM) as specific inhibitor

    • Measure ATP synthesis with uncouplers to confirm proton gradient dependence

    • Run parallel experiments measuring pH gradient using pH-sensitive fluorophores

This methodology allows quantitative assessment of ATP synthesis rates and efficiency under varying conditions .

What structural characterization techniques are most informative for studying H. halophila ATP synthase subunit a?

Multiple complementary structural characterization techniques provide comprehensive insights into H. halophila ATP synthase subunit a:

The combination of these approaches provides a comprehensive structural understanding from primary sequence to quaternary organization, revealing crucial insights about membrane integration, proton translocation pathway, and functional states .

How does the pH optimum of H. halophila ATP synthase compare with other bacterial and archaeal ATP synthases?

The pH optima of ATP synthases vary significantly across domains of life, reflecting evolutionary adaptations to different environments:

  • H. halophila ATP synthase, like other bacterial F-type ATP synthases, likely exhibits optimal ATP synthesis activity at intravesicular pH around 6.5

  • This contrasts with archaeal ATP synthases found in Halobacterium, which show maximal activity at pH 6.5 and become virtually inactive at pH 8.0, where F-type ATPases from typical bacteria are most active

  • The distinct pH preferences reflect fundamental differences in the proton-binding sites and conformational coupling mechanisms between A-type and F-type ATP synthases

  • These pH adaptations correlate with the physiological environments of the organisms - H. halophila maintains a more neutral internal pH despite living in alkaline soda lakes, while Halobacterium species often encounter more acidic microenvironments

  • The pH sensitivity also affects the directional preference (synthesis vs. hydrolysis) of the enzyme, with pH shifts potentially triggering changes in the equilibrium between these activities

These differences in pH optima provide important insights for experimental design when studying recombinant ATP synthases and highlight the evolutionary diversification of these enzymes .

What are the critical factors to consider when designing experiments to study the coupling between proton translocation and ATP synthesis in recombinant H. halophila ATP synthase?

When studying proton translocation-ATP synthesis coupling in recombinant H. halophila ATP synthase, researchers must consider several critical factors:

  • Membrane Reconstitution Integrity:

    • Ensure complete and uniform protein incorporation into liposomes

    • Verify vesicle tightness to protons using pH-sensitive dyes

    • Control protein orientation in the membrane to maintain physiological directionality

  • Energetic Threshold Requirements:

    • Establish membrane potential of at least -100 mV (inside-negative)

    • Maintain pH gradient of ≥1.6 units for effective ATP synthesis

    • Consider that combined smaller gradients of both ΔpH and Δψ may achieve threshold when neither alone is sufficient

  • Nucleotide and Cofactor Concentrations:

    • Optimize Mg²⁺ concentration (typically 2-5 mM)

    • Determine appropriate ADP concentration to avoid substrate inhibition

    • Control phosphate concentration to prevent inhibitory effects

  • Inhibitor Specificity:

    • Use DCCD at optimal concentration (25 μM/2 mg protein/ml) to block proton translocation

    • Compare effects of F₁-specific versus F₀-specific inhibitors to distinguish coupling steps

  • Real-time Monitoring Systems:

    • Simultaneously track proton movement and ATP synthesis

    • Correlate membrane potential changes with nucleotide conversion rates

    • Detect conformational changes during catalytic cycle using spectroscopic probes

  • Salt Concentration Effects:

    • Test activity across salt gradient to determine optimal ionic strength

    • Consider ion-specific effects (Na⁺ vs. K⁺) on coupling efficiency

This comprehensive approach enables quantitative assessment of the chemiosmotic coupling efficiency and mechanism in this halophilic ATP synthase .

What molecular features distinguish the ATP binding sites in H. halophila ATP synthase from those in archaeal A-type ATP synthases?

The ATP binding sites in H. halophila F-type ATP synthase differ significantly from archaeal A-type ATP synthases in several key molecular aspects:

  • Subunit Composition and Organization:

    • H. halophila (F-type): ATP binding occurs primarily at interfaces between α and β subunits, with catalytic sites mainly on β subunits

    • Archaeal A-type: Contains structurally related but distinct α and β subunits with different arrangements and approximately 30% sequence homology between them

  • Nucleotide Coordination:

    • F-type enzymes: Utilize Walker A (GxxGxGKT/S) and Walker B (hhhhDE) motifs for ATP binding

    • A-type enzymes: Feature similar phosphate-binding loops but with distinctive arginine finger positions and coordination geometry

  • Regulatory Site Architecture:

    • F-type synthases contain non-catalytic nucleotide binding sites that serve regulatory functions

    • A-type synthases may have alternative regulatory mechanisms, potentially involving c-di-GMP or other secondary messengers that interact with conserved arginine residues (R144, R185, R334)

  • Conformational Coupling Mechanism:

    • H. halophila likely follows the canonical rotary mechanism of F-type ATPases

    • Archaeal A-type ATPases may undergo unique conformational changes during catalysis, potentially reflecting their evolutionary relationship to V-type ATPases

  • Salt Adaptation Features:

    • H. halophila ATP binding sites may contain additional acidic residues surrounding the binding pocket to maintain function in high salt

    • Archaeal enzymes have evolved distinctive surface charge distributions that affect nucleotide binding kinetics and affinity

These molecular differences have significant implications for inhibitor design, kinetic properties, and functional regulation of these evolutionary distinct ATP synthases .

What emerging technologies show promise for elucidating the complete structure-function relationship of H. halophila ATP synthase?

Several emerging technologies hold significant promise for advancing our understanding of H. halophila ATP synthase structure-function relationships:

  • Time-Resolved Cryo-EM:

    • Captures intermediate conformational states during catalytic cycle

    • Reveals dynamic coupling between proton translocation and ATP synthesis

    • Potential to visualize the entire rotary mechanism in near-native environments

  • Single-Molecule FRET Spectroscopy:

    • Tracks rotational movement of the γ subunit relative to the α₃β₃ hexamer

    • Measures dwell times at different catalytic positions

    • Correlates conformational changes with specific biochemical steps

  • Molecular Dynamics Simulations:

    • Models protein behavior in halophilic environments

    • Predicts ion and water movements through the F₀ channel

    • Simulates conformational coupling between F₁ and F₀ domains

  • In-Cell Structural Biology:

    • Examines protein structure in native cellular environment

    • Reveals physiologically relevant interactions with other cellular components

    • Provides insights into organization within the bacterial membrane

  • Synthetic Biology Approaches:

    • Creates chimeric ATP synthases combining domains from different extremophiles

    • Develops minimal functional models to identify essential components

    • Engineers modified enzymes with enhanced stability or altered ion specificity

These technologies, particularly when used in complementary approaches, will help resolve remaining questions about the unique adaptations of H. halophila ATP synthase to extreme environments and may inform the development of biomimetic energy conversion systems .

How can insights from H. halophila ATP synthase research contribute to the development of bioenergetic systems for biotechnological applications?

Research on H. halophila ATP synthase offers valuable insights for developing novel bioenergetic systems with biotechnological applications:

  • Salt-Tolerant Biocatalysts:

    • The molecular adaptations enabling function in high salt can inform the design of industrial enzymes stable in non-conventional media

    • Engineered salt-stable ATP synthases could serve as platforms for ATP regeneration in biocatalytic processes

  • Light-Driven ATP Production:

    • Integration of light-harvesting systems with ATP synthases enables direct solar energy conversion to biochemical energy

    • Research on coupling between photosystems and ATP synthases in halophiles provides blueprints for artificial photosynthetic systems

  • Biomimetic Energy Conversion Devices:

    • The proton gradient mechanisms can inspire development of synthetic nanoscale rotary motors

    • Understanding of chemiosmotic coupling informs design of biomimetic fuel cells and energy storage solutions

  • Extremozyme Engineering:

    • Structure-function insights enable rational design of ATP synthases with enhanced stability in industrial conditions

    • The unique pH profile of halophilic ATP synthases offers opportunities for applications in alkaline industrial processes

  • Biosensors and Diagnostic Tools:

    • ATP synthase-based systems can serve as sensitive detectors for inhibitors, environmental toxins, or antimicrobial compounds

    • The well-characterized conformational changes can be harnessed for nanomechanical sensing applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.