AtpF (UniProt ID: A1WZT5) is a transmembrane protein encoded by the atpF gene in Halorhodospira halophila, a phototrophic extremophile thriving in hypersaline environments . The recombinant variant is produced to study its structural and functional roles in ATP synthesis under high-salt conditions.
Recombinant AtpF is synthesized using heterologous expression systems:
Expression: Optimized in E. coli or yeast, with codon-optimized sequences for high yield .
Solubility: Often forms inclusion bodies in E. coli, requiring urea solubilization and stepwise dialysis for refolding .
Storage: Lyophilized or in Tris-based buffer with 50% glycerol at -20°C/-80°C; avoid repeated freeze-thaw cycles .
Transmembrane Helices: Critical for anchoring the F sector to the membrane .
Proton Channel Interface: Facilitates H translocation via conserved polar residues (e.g., Arg52, Asp21) .
ATPase Activity: Assayed via NADH-coupled enzymatic methods .
Ligand Binding: Exhibits cooperative ligand binding, modeled via the KNF sequential mechanism .
Halorhodospira halophila AtpF shares <30% sequence identity with eubacterial F-type ATPases but >50% identity with eukaryotic vacuolar ATPases, classifying it as A-type ATP synthase .
| Feature | H. halophila AtpF | Eubacterial F-type AtpF |
|---|---|---|
| Sequence Identity | ~55–66% (archaeal ATPases) | <30% |
| Stabilization Strategy | Salt-bridge networks | Hydrophobic interactions |
| Optimal NaCl | 5–30% (w/v) | <5% (w/v) |
Enzyme Mechanism Studies: Used to probe proton-coupled ATP synthesis in extremophiles .
Structural Biology: Crystallization trials for resolving A-type ATP synthase architecture .
Biotechnological Tools: Antigen in ELISA for antibody production .
KEGG: hha:Hhal_2434
STRING: 349124.Hhal_2434
ATP synthase subunit b (atpF) is a critical component of the F-type ATP synthase complex in Halorhodospira halophila, a photosynthetic extremophile bacterium belonging to the Halorhodospiraceae family. This protein is part of the peripheral stalk (also known as the stator) of the ATP synthase complex, which helps anchor the catalytic F₁ portion to the membrane-embedded F₀ portion. In H. halophila, atpF plays a crucial role in maintaining the structural integrity of the ATP synthase complex during the rotational catalysis that drives ATP production .
The protein is significant in research for several reasons:
It provides insights into energy metabolism in extremophilic bacteria
It serves as a model for studying ATP synthase assembly in photosynthetic organisms
Its unique adaptations allow it to function in high-salt environments
It contributes to our understanding of bioenergetic processes in phototrophic bacteria
The recombinant H. halophila ATP synthase subunit b protein has well-defined molecular characteristics that are important for researchers to understand:
| Parameter | Characteristic | Details |
|---|---|---|
| UniProt ID | A1WZT5 | Reference identifier in UniProt database |
| Protein Length | 156 amino acids | Full-length expression region (1-156) |
| Amino Acid Sequence | MNFGATFWGPMISFALFVWFTMKFVWPPIQQA LADRQKQIADGLAAGERGKEELDKAQAEVEA mLRDAREQASQIINQANKRQAEMIEEARAE ARSEADRILASAREEIDQEIQRAREDLRKQ VSTIAVQASSQILKREVDAKAHKDLIDELAT QI | Complete primary structure |
| Gene Name | atpF | Standard gene nomenclature |
| Locus Name | Hhal_2434 | Genomic location identifier |
| Alternative Names | ATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b | Various nomenclature used in literature |
This protein is typically produced as a recombinant protein in expression systems with an affinity tag to facilitate purification while maintaining its native structure and function .
The atpF protein (ATP synthase subunit b) forms an extended α-helical structure that serves as part of the peripheral stalk of the ATP synthase complex. This peripheral stalk is crucial for countering the torque generated during ATP synthesis.
The protein structure consists of:
A hydrophobic N-terminal domain that anchors the protein in the membrane
A central region that interacts with other stator components
A C-terminal domain that connects to the F₁ catalytic sector
During ATP synthesis, the protein maintains the structural stability of the complex while allowing the central rotor to rotate within the stationary parts of the enzyme. This rotation is driven by the proton gradient established during photosynthesis in H. halophila .
The protein's structure is particularly adapted to function in the extreme halophilic environment where H. halophila thrives, requiring specific amino acid compositions that maintain stability under high salt conditions .
For optimal stability and activity of recombinant H. halophila ATP synthase subunit b, the following storage and handling conditions are recommended:
| Condition | Recommendation | Rationale |
|---|---|---|
| Short-term Storage | 4°C for up to one week | Maintains protein stability for routine experiments |
| Long-term Storage | -20°C or -80°C | Prevents degradation for extended periods |
| Storage Buffer | Tris-based buffer with 50% glycerol | Optimized for protein stability |
| Thawing Protocol | Gentle thawing on ice | Minimizes protein denaturation |
| Freeze-Thaw Cycles | Avoid repeated freeze-thawing | Repeated cycles cause protein degradation |
| Working Concentration | Prepare working aliquots | Reduces the need for repeated freeze-thawing |
When handling the protein, it's important to maintain a consistent temperature and avoid introducing proteases or other contaminants. For experiments requiring active protein, aliquoting the stock solution into smaller volumes is strongly recommended to preserve the integrity of the remaining sample .
The most effective purification strategy for recombinant H. halophila ATP synthase subunit b involves a multi-step approach that maximizes purity while maintaining protein functionality:
Initial Capture: Ni²⁺-affinity chromatography is highly effective for His-tagged recombinant atpF, providing a high degree of selectivity.
Intermediate Purification: Anion-exchange chromatography is recommended as a second step to remove remaining contaminants and achieve higher purity.
Polishing Step: Size exclusion chromatography can be used to separate the properly folded protein from aggregates and to exchange the buffer.
For researchers encountering difficulties with protein solubility, consider:
Adding low concentrations of non-ionic detergents (0.05-0.1% Triton X-100)
Increasing salt concentration in buffers (particularly important for proteins from halophilic organisms)
Optimizing pH conditions based on the protein's theoretical isoelectric point
This purification approach has been successfully applied to similar proteins from H. halophila, demonstrating its effectiveness for obtaining pure, active protein .
Multiple complementary techniques should be employed to comprehensively assess the structural integrity and oligomeric state of recombinant H. halophila ATP synthase subunit b:
Size Exclusion Chromatography (SEC):
Analytical Ultracentrifugation:
Provides accurate molecular mass determination in solution
Can distinguish between different oligomeric states
Dynamic Light Scattering (DLS):
Measures the hydrodynamic radius of the protein
Useful for detecting aggregation
Circular Dichroism (CD) Spectroscopy:
Assesses secondary structure content
Confirms proper folding of α-helical domains expected in atpF
Thermal Shift Assays:
Evaluates protein stability under different buffer conditions
Particularly important for proteins from extremophiles
When analyzing results, researchers should note that the atpF protein from H. halophila, like similar proteins from related species, may form distinctive oligomeric assemblies that are crucial for its biological function .
While isolated atpF itself does not have enzymatic activity, its functionality can be assessed through several approaches that evaluate its ability to participate in ATP synthase complex assembly and function:
Reconstitution Assays:
Combining recombinant atpF with other ATP synthase components to reconstitute partial or complete complexes
Measuring ATP synthesis activity of the reconstituted complex
Comparing activity with and without the recombinant atpF component
Binding Assays:
Surface plasmon resonance (SPR) to measure binding kinetics with other subunits
Isothermal titration calorimetry (ITC) to determine binding thermodynamics
Pull-down assays to confirm interactions with partner proteins
Structural Integrity Assessment:
Limited proteolysis to assess proper folding
Thermal stability assays to determine whether the protein maintains its expected stability
Functional Complementation:
Expression of recombinant atpF in atpF-deficient bacterial strains
Assessing restoration of ATP synthesis capacity
When designing these assays, it's important to consider the halophilic nature of the protein, as it may require specific buffer conditions with elevated salt concentrations to maintain its native structure and function .
H. halophila is an extremely halophilic phototroph that thrives in high-salt environments, and its ATP synthase subunit b (atpF) plays a significant role in this adaptation:
Structural Adaptations:
The amino acid composition of atpF likely contains a higher proportion of acidic residues (Asp, Glu) on the protein surface
This adaptation increases protein solubility and stability in high-salt environments
The protein maintains structural flexibility necessary for ATP synthase function despite extreme conditions
Bioenergetic Contributions:
ATP synthase must function efficiently despite high salt concentrations
The atpF protein helps maintain the structural integrity of the ATP synthase complex during these challenging conditions
This ensures continued ATP production to meet energy demands for osmoadaptation mechanisms
Integration with Other Metabolic Systems:
ATP synthase in H. halophila works in concert with photosynthetic electron transport chains
The protein may interact with other systems involved in maintaining redox balance and energy production under extreme conditions
Recent proteomics research suggests coordination between ATP synthesis and sulfur/arsenic metabolism pathways
This adaptation is particularly significant as it represents a bacterial strategy for extremophily that differs from the archaea that typically dominate such environments .
The ATP synthase subunit b (atpF) in H. halophila functions as an integral component of the energy production machinery, particularly in the context of anoxygenic photosynthesis:
Integration with Photosynthetic Electron Transport:
H. halophila performs anoxygenic photosynthesis using sulfur compounds and potentially arsenite as electron donors
The electron transport chain generates a proton gradient across the membrane
ATP synthase, with atpF as a critical structural component, utilizes this gradient to produce ATP
Coordination with Sulfur Metabolism:
Recent proteomics research has revealed that in H. halophila, ATP synthesis is coordinated with sulfur oxidation pathways
The SoxAXYZB system, which is involved in thiosulfate oxidation, shows significant expression changes under different growth conditions
This suggests a tight coordination between electron donor oxidation and ATP production
Unique Aspects in H. halophila:
Comparative analysis reveals important similarities and differences between H. halophila ATP synthase subunit b and its homologs in other organisms:
Research in Chlamydomonas reinhardtii has shown that both peripheral stalk proteins (b and b′) are essential for ATP synthase biogenesis and function in chloroplasts, suggesting a similar critical role for atpF in H. halophila . The unique adaptations in H. halophila atpF likely contribute to its ability to function in extreme environments while maintaining the core structural features necessary for ATP synthase assembly.
Studying the assembly of ATP synthase complexes with recombinant atpF requires sophisticated experimental approaches:
In vitro Reconstitution Systems:
Stepwise addition of purified subunits to monitor complex assembly
Assessment of intermediate complexes using analytical techniques
Evaluation of how atpF incorporation affects complex stability and formation
Fluorescence-based Approaches:
FRET (Förster Resonance Energy Transfer) to monitor protein-protein interactions
Fluorescently labeled atpF to track its incorporation into complexes
Single-molecule fluorescence to observe assembly dynamics
Cryo-electron Microscopy:
Visualization of ATP synthase complexes at different assembly stages
Structural determination of fully assembled complexes
Comparison of structures with and without recombinant atpF
Mass Spectrometry-based Techniques:
Hydrogen-deuterium exchange mass spectrometry to identify interaction interfaces
Cross-linking mass spectrometry to capture transient interactions
Native mass spectrometry to determine subunit stoichiometry
Genetic Approaches in Model Systems:
Complementation studies in ATP synthase-deficient strains
Site-directed mutagenesis to identify critical residues for assembly
Synthetic biology approaches to create hybrid ATP synthase complexes
These methods could reveal how atpF from an extremophile like H. halophila might affect ATP synthase assembly differently than homologs from non-extremophiles .
Researchers face several challenges when interpreting structural data for H. halophila ATP synthase subunit b:
Conformational Flexibility:
The peripheral stalk, including atpF, often exhibits flexibility that complicates structural determination
Solution: Combine multiple structural techniques (X-ray crystallography, cryo-EM, SAXS) to obtain a complete picture
Approach: Use computational molecular dynamics simulations to model flexible regions
Oligomeric State Heterogeneity:
atpF may exist in multiple oligomeric states depending on conditions
Solution: Analyze samples under various conditions to identify physiologically relevant states
Approach: Use analytical ultracentrifugation and native mass spectrometry to characterize oligomeric distribution
Halophilic Adaptations:
Structural features related to halophilic adaptation may be difficult to distinguish from core functional features
Solution: Comparative analysis with non-halophilic homologs
Approach: Systematically modify salt concentrations during structural studies
Integration with Other Subunits:
When proteins from extremophiles like H. halophila are studied structurally, special attention must be paid to maintaining physiologically relevant conditions throughout the experimental process to avoid artifacts.
Researchers commonly encounter several challenges when working with recombinant H. halophila ATP synthase subunit b:
| Challenge | Cause | Solution |
|---|---|---|
| Poor Expression Yield | Codon bias in heterologous expression systems | Use codon-optimized gene sequences; express in Rosetta strains with rare tRNAs |
| Protein Insolubility | Membrane association of the N-terminal domain | Include mild detergents (0.1% DDM or LDAO) in lysis and purification buffers |
| Aggregation | Improper folding or inadequate salt concentration | Increase salt concentration (0.5-1M NaCl) to mimic halophilic conditions |
| Proteolytic Degradation | Instability in non-native environments | Add protease inhibitor cocktail; reduce expression temperature to 18-20°C |
| Loss of Structure | Non-optimal buffer conditions | Include stabilizing agents like glycerol (10-15%); optimize pH based on theoretical pI |
| Tag Interference | Affinity tags affecting protein function | Test multiple tag positions (N-terminal vs. C-terminal); include cleavable tags |
When purifying this protein, researchers have found success using a two-step protocol combining Ni²⁺-affinity chromatography followed by anion-exchange chromatography, similar to the approach used for other H. halophila proteins . This method helps achieve both purity and functional integrity.
Maintaining the stability of recombinant H. halophila ATP synthase subunit b during functional studies requires specific approaches:
Buffer Optimization:
Include higher salt concentrations (0.5-1M NaCl) to mimic the halophilic environment
Add stabilizing agents such as glycerol (20-50%) to prevent denaturation
Optimize pH to match the protein's natural environment (typically pH 7.5-8.5)
Temperature Management:
Perform experiments at lower temperatures (4-20°C) to reduce thermal denaturation
Avoid rapid temperature changes that could affect protein folding
Pre-incubate samples at experimental temperature before measurements
Additive Screening:
Test various additives (amino acids, polyols, sugars) for their stabilizing effects
Consider adding specific metal ions (Mg²⁺, Mn²⁺) that may enhance stability
Use commercial additive screens designed for membrane-associated proteins
Protein Engineering Approaches:
Introduce strategic mutations to enhance stability without affecting function
Create truncated constructs that maintain core functional domains
Consider fusion partners known to enhance protein stability
Research has shown that proteins from H. halophila, like other halophilic proteins, often maintain their structure and function best in high-salt environments that mimic their native conditions . Careful attention to these factors will help ensure reliable results in functional studies.
Rigorous experimental design for studies involving recombinant H. halophila ATP synthase subunit b should include these essential controls:
Protein Quality Controls:
Purity assessment via SDS-PAGE and mass spectrometry
Thermal shift assays to confirm proper folding
Circular dichroism to verify secondary structure content
Size exclusion chromatography to check for aggregation
Functional Controls:
Inactive mutant versions (e.g., site-directed mutations at key residues)
Homologous proteins from related organisms for comparative analysis
Denatured protein samples as negative controls
Commercial ATP synthase preparations as positive controls when applicable
Experimental Condition Controls:
Buffer-only controls to account for background signals
Varying salt concentrations to establish optimal conditions
Time-course measurements to ensure stability throughout experiments
Temperature controls to assess thermal dependence of observations
System-specific Controls:
If studying assembly, include partial complexes lacking atpF
For interaction studies, include non-interacting proteins as negative controls
In reconstitution experiments, vary stoichiometry of components
For immunological detection, include pre-immune sera controls
Implementing these controls will help distinguish specific effects of the recombinant atpF protein from artifacts or background noise, increasing the reliability and reproducibility of research findings .
Research on H. halophila ATP synthase subunit b opens several promising avenues for advancing our understanding of extremophilic bioenergetics:
Molecular Adaptation Mechanisms:
Detailed characterization of atpF structural adaptations provides insights into how energy-generating machinery can function under extreme conditions
Comparative genomics and proteomics approaches can reveal evolutionary pathways to extremophily
Such knowledge extends our understanding of the limits of biological energy transduction
Novel Biochemical Pathways:
Recent proteomics research has revealed connections between ATP synthesis and unique metabolic pathways in H. halophila
The relationship between ATP synthase function and the Sox system's role in sulfur and arsenic metabolism represents a frontier in bioenergetics research
These connections may reveal novel energy coupling mechanisms not observed in mesophilic organisms
Biotechnological Applications:
Understanding how atpF contributes to ATP synthase stability in extreme environments could inform the design of more robust bioenergetic systems
Engineered ATP synthases incorporating features from extremophiles might function in harsh industrial conditions
Principles derived from halophilic adaptations could improve protein engineering approaches for various applications
This research area intersects with astrobiology, providing insights into how life might adapt to generate energy under extreme conditions on other planets or moons .
Cutting-edge techniques are transforming our ability to study the dynamic assembly of ATP synthase complexes incorporating atpF:
Time-Resolved Cryo-Electron Microscopy:
Captures structural snapshots of assembly intermediates
Allows visualization of conformational changes during complex formation
Recent advances in sample preparation and image processing have made this increasingly feasible for membrane protein complexes
Single-Molecule Techniques:
Single-molecule FRET to track protein-protein interactions in real-time
Optical tweezers to measure forces involved in complex assembly
These approaches provide insights into assembly kinetics not accessible through bulk measurements
Integrative Structural Biology:
Combines multiple data sources (cryo-EM, cross-linking MS, computational modeling)
Creates comprehensive models of assembly pathways
Particularly valuable for flexible regions like those in atpF
In-cell Structural Biology:
Techniques like in-cell NMR and cryo-electron tomography
Studies protein structure and interactions in their native environment
Provides context for understanding how cellular factors influence assembly
Computational Approaches:
Molecular dynamics simulations of assembly processes
Machine learning for predicting protein-protein interaction sites
These computational tools help interpret experimental data and guide further experiments
These emerging techniques complement the structural insights already gained from studies of related proteins, enabling a more dynamic understanding of ATP synthase assembly .
The structure-function relationship of ATP synthase subunit b provides valuable insights into the evolutionary history and adaptability of this critical bioenergetic complex:
Evolutionary Conservation and Divergence:
The core structural elements of atpF are conserved across diverse organisms, reflecting fundamental constraints on ATP synthase function
Variations in sequence and structural details reveal adaptive changes for different environments
Comparison between H. halophila atpF and homologs from archaea, bacteria, and eukaryotes illuminates evolutionary trajectories
Modular Evolution of ATP Synthase:
Research suggests that different components of ATP synthase evolved with varying degrees of conservation
The peripheral stalk, including atpF, shows more sequence divergence while maintaining structural roles
This pattern indicates modular evolution where some components adapted while core catalytic machinery remained conserved
Convergent Evolution in Extremophiles:
Comparison of H. halophila atpF with proteins from halophilic archaea may reveal convergent adaptations
Similar molecular solutions (e.g., increased acidic residues) despite different evolutionary origins
These patterns provide natural experiments in protein adaptation to extreme conditions
Implications for Endosymbiotic Origin of Organelles:
Comparative studies with chloroplast ATP synthase, which has two peripheral stalk proteins (b and b′), inform our understanding of endosymbiotic events
Research in Chlamydomonas reinhardtii has shown that both peripheral stalk proteins are essential for ATP synthase biogenesis, suggesting evolutionary specialization