Recombinant Halorubrum lacusprofundi UPF0290 protein Hlac_0350 (Hlac_0350)

Shipped with Ice Packs
In Stock

Description

Introduction to Halorubrum lacusprofundi and UPF0290 Protein Family

Halorubrum lacusprofundi is an extremophilic archaeon originally isolated from Deep Lake, Antarctica, characterized by its ability to survive in hypersaline and cold environments. This organism belongs to the Halobacteriaceae family, distinguished by its remarkable adaptations to extreme conditions, including high salt concentrations and low temperatures . The genome of Halorubrum lacusprofundi has been fully sequenced, with strain references including ATCC 49239, DSM 5036, JCM 8891, and ACAM 34, allowing for comprehensive genomic and proteomic studies of this unique organism .

The UPF0290 protein family, to which Hlac_0350 belongs, represents a group of uncharacterized protein families (UPF) with conserved sequences across various organisms but with poorly defined functions. The designation "UPF0290" indicates that this protein family is the 290th entry in the database of uncharacterized protein families . These proteins often represent intriguing targets for functional genomics and structural biology studies, as elucidating their functions can provide significant insights into novel biological processes and evolutionary relationships.

Taxonomic Context and Evolutionary Significance

Within the taxonomic hierarchy, Halorubrum lacusprofundi occupies a unique position among extremophilic archaeons. The species is particularly notable for its adaptation to both high salt environments and cold temperatures, making its protein repertoire especially interesting for researchers studying protein stability under extreme conditions . The UPF0290 protein Hlac_0350 may play specific roles in these adaptations, though detailed functional characterization appears limited in current research literature.

Historical Context of Protein Discovery

The identification of Hlac_0350 likely emerged from comprehensive genomic sequencing projects focusing on extremophilic organisms. While specific discovery information is not detailed in the available search results, the protein has been assigned the UniProt accession number B9LSA9, indicating its formal recognition and classification within standardized protein databases .

Protein Structure and Sequence Analysis

Analysis of the amino acid sequence reveals several notable features characteristic of proteins from halophilic archaea. The sequence appears to contain hydrophobic clusters that may facilitate membrane interactions, as well as charged residues that could contribute to protein stability in high-salt environments . While detailed structural information is not provided in the search results, the UPF0290 family typically consists of proteins with conserved structural domains that may provide clues to potential functions.

Gene Organization and Expression

The gene encoding Hlac_0350 is designated with the ordered locus name "Hlac_0350" within the Halorubrum lacusprofundi genome . The expression region encompasses positions 1-180, suggesting that the entire protein coding sequence is utilized without significant post-translational modifications that would alter the length of the mature protein . This information provides valuable context for researchers interested in the genomic organization and expression patterns of this gene.

Production and Recombinant Expression Systems

The recombinant Hlac_0350 protein is produced using Escherichia coli as the expression host, a standard practice in recombinant protein production due to the organism's rapid growth and well-established genetic manipulation techniques . This heterologous expression system allows for the efficient production of archaeal proteins that might otherwise be challenging to obtain in sufficient quantities from their native organisms, particularly those from extreme environments like Halorubrum lacusprofundi.

Purification and Quality Control

The commercially available recombinant Hlac_0350 protein undergoes rigorous purification processes to achieve high purity levels. According to product specifications, the protein exhibits greater than 85% purity as determined by SDS-PAGE analysis . This level of purity is important for research applications where contaminants could interfere with experimental outcomes. The purification process likely involves affinity chromatography leveraging fusion tags, though the specific tag type used varies and is determined during the production process .

Protein Modifications and Tags

The recombinant Hlac_0350 protein may include fusion tags to facilitate purification, although specific tag information is not predetermined and varies according to manufacturing processes . These tags typically do not interfere with protein function but can be considered when designing experiments. Different vendors may use various tag systems, which should be taken into account when comparing products from different sources.

Product Applications and Research Relevance

While specific applications are not detailed in the search results, recombinant proteins from extremophilic organisms like Halorubrum lacusprofundi typically find utility in various research contexts. These may include studies on protein stability under extreme conditions, evolutionary analyses of archaeal proteins, structural biology investigations, and enzyme characterization studies . The UPF0290 protein family, being uncharacterized, presents opportunities for novel discoveries regarding protein function and evolutionary relationships.

Reconstitution Protocols

For lyophilized forms of the protein, proper reconstitution is essential. The recommended procedure involves brief centrifugation of the vial prior to opening to ensure all contents are at the bottom . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) recommended for samples intended for long-term storage . Manufacturers typically use a default final glycerol concentration of 50%.

Molecular Function and Biological Role

The UPF0290 protein family, including Hlac_0350, remains largely uncharacterized in terms of specific biological functions. While precise functional data is not provided in the search results, the protein's presence in an extremophilic archaeon suggests potential roles in adaptation to harsh environmental conditions. Some commercial listings associate the gene with "carS" as a target name, potentially indicating a connection to cysteinyl-tRNA synthetase functions, though this association requires further validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us. We will prioritize development of the specified tag.
Synonyms
carS; Hlac_0350; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
Target Names
carS
Target Protein Sequence
MIGSLVATAFWAMLPAYVPNNAAVLAGGGRPIDGGRDWRGARLLGDGKTWRGTAVGTLTG VVLALALNRIAEPASAALGVDLPTFALPAAFALAFGAMCGDIGASFLKRRSGRERGAAFP GLDQLDFVVVALAAVFVVDTDWALAVFTPSVLVVVLVMTPILHVVTNVGAYALGLKNEPW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Halorubrum lacusprofundi UPF0290 protein Hlac_0350 and what makes it significant for research?

The Halorubrum lacusprofundi UPF0290 protein Hlac_0350 is a protein encoded by the Hlac_0350 gene in the extremophilic archaeon Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) . This protein belongs to the UPF0290 family, a group of proteins with unknown function. The significance of this protein stems from its origin in a polyextremophilic organism capable of surviving in both high-salt and extremely cold environments .

Research on this protein is valuable for understanding molecular adaptations to extreme conditions, potentially revealing novel mechanisms of protein stability, enzymatic activity, and structural flexibility under harsh conditions. The insights gained could be applicable to biotechnology, astrobiology, and the study of potential extraterrestrial life forms adapted to extreme environments .

What are the structural characteristics of the Hlac_0350 protein?

The Hlac_0350 protein consists of 180 amino acids with the sequence beginning with MIGSLVATAFWA and ending with AYALGLKNEPW . The protein's predicted structure would likely display adaptations typical of extremophilic proteins, including:

  • Increased surface negative charges to maintain protein solubility in high-salt environments

  • Higher proportion of acidic residues compared to basic residues

  • Reduced hydrophobic core packing to maintain flexibility at low temperatures

  • Potentially unique structural elements that contribute to stability in both cold and high-salt conditions

To fully characterize the structure, researchers would typically employ techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy, similar to methods used for other proteins from H. lacusprofundi .

How should researchers store and handle recombinant Hlac_0350 protein to maintain its integrity?

For optimal storage and handling of recombinant Hlac_0350 protein, follow these research-validated protocols:

Storage Recommendations:

  • Store at -20°C for regular use

  • For extended storage, maintain at -80°C

  • Store in Tris-based buffer with 50% glycerol that has been optimized for this protein

  • Avoid repeated freeze-thaw cycles which can degrade protein structure and function

  • Prepare working aliquots and store at 4°C for up to one week

Handling Considerations:

  • When thawing, place on ice and allow gradual warming to 4°C

  • For experiments requiring room temperature work, minimize exposure time

  • Maintain salt concentration appropriate for halophilic proteins (typically ≥2M NaCl or KCl)

  • Consider adding protease inhibitors if working with cell lysates containing the protein

  • Document all freeze-thaw cycles and storage conditions in laboratory notes to account for potential variation in experimental results

How does the amino acid composition of Hlac_0350 contribute to its adaptation to both high-salt and cold environments?

The dual extremophilic adaptation of Hlac_0350 to both high-salt and cold environments involves sophisticated molecular mechanisms that can be analyzed through its amino acid composition and structural arrangements:

High-Salt Adaptation Features:

  • Enrichment of acidic residues (Asp, Glu) on the protein surface creating a negative charge shell that interacts with hydrated salt ions

  • Reduction in lysine residues compared to non-halophilic homologs

  • Increased proportion of small hydrophobic residues (Ala, Val) in the protein core

  • Presence of salt bridges and ion-binding sites that stabilize the protein structure

Cold Adaptation Features:

  • Reduced proline content in loop regions, increasing structural flexibility

  • Higher proportion of glycine residues allowing for greater conformational freedom

  • Weakened hydrophobic interactions in the protein core, preventing cold-induced rigidity

  • Potential clustering of charged residues to maintain solubility at low temperatures

The amino acid sequence of Hlac_0350 (MIGSLVATAFWA...AYALGLKNEPW) suggests a membrane-associated protein with both hydrophobic and hydrophilic regions. The presence of both alanine-rich regions (associated with structural flexibility) and glycine residues (providing conformational freedom) supports adaptation to cold environments, while the numerous acidic residues likely contribute to salt tolerance.

Research methods to investigate these features would include comparative sequence analysis with non-extremophilic homologs, molecular dynamics simulations under varying temperature and salt conditions, and experimental validation through site-directed mutagenesis of key residues.

What experimental approaches are most effective for determining the function of the UPF0290 protein family in extremophilic archaea?

Determining the function of UPF0290 proteins like Hlac_0350 in extremophilic archaea requires a multi-faceted experimental approach:

Comparative Genomics and In Silico Analysis:

  • Phylogenetic analysis to identify evolutionary relationships with proteins of known function

  • Structural modeling to predict functional domains and potential binding sites

  • Analysis of gene neighborhood and co-expression patterns to identify functional associations

  • Prediction of subcellular localization to indicate potential functional environment

Experimental Approaches:

  • Gene Knockout/Knockdown Studies:

    • CRISPR-Cas9 or traditional homologous recombination techniques adapted for haloarchaea

    • Phenotypic analysis under various stress conditions (temperature, salinity, pH)

    • Transcriptomic analysis of knockout strains to identify affected pathways

  • Protein Interaction Studies:

    • Pull-down assays with tagged Hlac_0350 under high-salt conditions

    • Yeast two-hybrid systems adapted for halophilic proteins

    • Protein cross-linking followed by mass spectrometry

    • Co-immunoprecipitation with potential interacting partners

  • Biochemical Characterization:

    • Activity assays for common enzymatic functions (hydrolase, transferase, etc.)

    • Substrate screening using metabolite arrays

    • Structural studies under varying temperature and salt conditions

    • Ligand binding assays to identify potential substrates or cofactors

  • Localization Studies:

    • Fluorescent protein tagging adapted for extremophilic conditions

    • Immunogold electron microscopy to determine precise subcellular localization

    • Cell fractionation followed by Western blotting

For UPF0290 specifically, focusing on potential membrane-associated functions would be warranted given the sequence characteristics , potentially investigating roles in cell membrane stability under extreme conditions.

How can researchers effectively compare the stability and activity of Hlac_0350 across varying salt concentrations and temperature ranges?

To effectively compare stability and activity of Hlac_0350 across different salt concentrations and temperatures, researchers should implement a systematic approach with standardized methods:

Experimental Design Matrix:

Temperature (°C)Salt Concentration (% w/v)
5%10%20%30%
-5Condition 1Condition 2Condition 3Condition 4
4Condition 5Condition 6Condition 7Condition 8
25Condition 9Condition 10Condition 11Condition 12
50Condition 13Condition 14Condition 15Condition 16

Stability Assessment Methods:

  • Thermal Shift Assays:

    • Monitor protein unfolding using differential scanning fluorimetry

    • Calculate melting temperatures (Tm) across salt concentration gradient

    • Compare salt-dependent thermal stability profiles

  • Circular Dichroism Spectroscopy:

    • Measure secondary structure content at different temperatures and salt concentrations

    • Track temperature-dependent unfolding at fixed salt concentrations

    • Quantify salt-dependent structural changes at fixed temperatures

  • Dynamic Light Scattering:

    • Monitor aggregation state and hydrodynamic radius

    • Determine conditions leading to oligomerization or aggregation

    • Assess colloidal stability under varying conditions

  • Limited Proteolysis:

    • Expose protein to proteases under different conditions

    • Analyze digestion patterns by SDS-PAGE or mass spectrometry

    • Identify regions with condition-dependent flexibility

Activity Assessment Methods:

  • Design activity assays based on predicted function (if known) or generalized assays for potential functions

  • Measure reaction rates across the temperature-salt matrix

  • Calculate activation energies and thermodynamic parameters

  • Determine optimal conditions for activity and stability

Data Analysis Approach:

  • Generate 3D contour plots of stability/activity across temperature and salt axes

  • Calculate Q10 values (rate change per 10°C) at different salt concentrations

  • Determine the activation energy (Ea) using Arrhenius plots at different salt concentrations

  • Apply multivariate statistical analysis to identify synergistic effects between temperature and salt

This comprehensive approach would provide insights into how Hlac_0350 balances stability and function across the extreme conditions encountered in its natural habitat, such as Antarctica's Deep Lake .

What are the optimal conditions for expressing recombinant Hlac_0350 protein in laboratory settings?

Expressing recombinant Hlac_0350 from an extremophilic archaeon presents unique challenges requiring specialized expression systems and conditions:

Expression System Selection:

Expression SystemAdvantagesDisadvantagesRecommended Modifications
E. coliHigh yield, simple cultivationPoor folding of halophilic proteins, potential toxicityUse salt-adapted strains (e.g., E. coli KM71), addition of osmolytes to media
Haloferax volcaniiNatural halophilic environment, proper foldingLower yields, specialized growth requirementsOptimize promoters for controlled expression, develop improved selection markers
Pichia pastorisEukaryotic folding machinery, high density culturesMay not accommodate halophilic protein foldingAddition of salt to growth media, lower expression temperature
Cell-free systemsCustomizable reaction conditions with high saltExpensive, lower yieldsPrepare extracts from halophilic organisms, supplement with chaperones

Optimized Protocol for E. coli Expression:

  • Vector Design:

    • Select vectors with tightly controlled promoters (e.g., T7lac)

    • Include solubility-enhancing fusion tags (MBP, SUMO, or halophilic tags)

    • Optimize codon usage for E. coli while preserving key rare codons

  • Growth Conditions:

    • Culture temperature: 16-18°C after induction

    • Media supplementation: 0.5-2M NaCl, 10% glycerol, 1mM betaine

    • Extended induction period (16-24 hours) at low IPTG concentration (0.1-0.2mM)

    • Consider auto-induction media for gradual protein expression

  • Extraction and Purification:

    • Lysis in high-salt buffer (2-3M KCl or NaCl)

    • Include stabilizing agents (glycerol, specific ions)

    • Utilize affinity chromatography under high-salt conditions

    • Consider refolding protocols if protein forms inclusion bodies

Alternative Approach: Haloferax-Based Expression:

  • Transform expression construct into Haloferax volcanii

  • Culture in 23% salt media at 42°C for optimal growth

  • Use strong inducible promoters (e.g., p.tnaA)

  • Extract using mild detergents to maintain native folding

Monitoring expression using techniques adapted for high-salt conditions, such as modified Western blotting protocols or activity assays conducted in high-salt buffers, is essential for accurate quantification and quality assessment.

What purification strategies maximize yield and maintain functionality of Hlac_0350 protein?

Purifying halophilic proteins like Hlac_0350 requires specialized approaches to maintain their unique structural requirements throughout the purification process:

Purification Strategy Comparison:

Purification MethodSalt RequirementAdvantagesChallengesOptimization Strategies
Immobilized Metal Affinity Chromatography (IMAC)High (2-3M KCl/NaCl)Specific binding via His-tagMetal ion leaching in high saltUse cobalt resins, shorter columns, higher flow rates
Ion Exchange ChromatographyGradient (0.5-3M)High resolution separationProtein destabilization during low-salt stepsApply salt gradient elution, avoid very low salt conditions
Hydrophobic InteractionHigh initial, decreasingComplements other methodsPotential aggregation during elutionInclude stabilizing additives, controlled elution rates
Size ExclusionConstant high saltNo salt gradient needed, gentleLimited resolutionUse pre-equilibrated columns, optimized buffer compositions
Heparin AffinityHigh (1-2M)Useful for DNA-binding proteinsNon-specific interactionsOptimize binding and elution conditions

Recommended Multi-Step Purification Protocol:

  • Initial Capture:

    • IMAC using Ni-NTA or Co-Talon resin

    • Equilibration buffer: 50mM Tris-HCl pH 8.0, 2M KCl, 20mM imidazole

    • Wash buffer: Same with 50mM imidazole

    • Elution buffer: Same with 250mM imidazole gradient

    • Include 10% glycerol throughout to enhance stability

  • Intermediate Purification:

    • Ion exchange chromatography (typically anion exchange for halophilic proteins)

    • Start with high salt (2M KCl) and elute with increasing KCl concentration

    • Monitor elution peaks with activity assays adapted to high salt

  • Polishing Step:

    • Size exclusion chromatography in stabilizing buffer

    • Buffer: 50mM Tris-HCl pH 8.0, 2M KCl, 10% glycerol

    • Analyze fractions by SDS-PAGE and activity assays

Quality Control Assessments:

  • Dynamic light scattering to verify monodispersity

  • Circular dichroism to confirm secondary structure integrity

  • Activity assays under native-like high-salt conditions

  • Mass spectrometry to confirm protein identity and modifications

Yield Optimization Strategies:

  • Implement tangential flow filtration between steps

  • Minimize buffer exchange steps that might induce aggregation

  • Use stabilizing additives (e.g., specific ions known to stabilize halophilic proteins)

  • Consider performing all steps at lower temperature (4-10°C) while maintaining high salt

Thorough documentation of purification conditions and yields at each step will help optimize the process for specific research applications involving Hlac_0350.

What analytical techniques are most appropriate for characterizing the structure-function relationship of Hlac_0350?

Characterizing the structure-function relationship of extremophilic proteins like Hlac_0350 requires specialized analytical techniques adapted to high-salt and low-temperature conditions:

Structural Characterization Techniques:

Functional Characterization Techniques:

  • Enzyme Kinetics (if enzymatic function is identified):

    • Spectrophotometric assays adapted for high-salt conditions

    • Temperature-dependent activity measurements

    • Determination of kinetic parameters (Km, kcat) across salt and temperature ranges

  • Binding Studies:

    • Isothermal Titration Calorimetry (ITC) modified for high-salt buffers

    • Surface Plasmon Resonance (SPR) with salt-resistant sensor chips

    • Microscale Thermophoresis (MST) for detection of subtle binding events

  • Computational Approaches:

    • Molecular dynamics simulations in explicit high-salt environments

    • Quantum mechanics/molecular mechanics (QM/MM) for catalytic mechanism studies

    • Protein-ligand docking to predict potential binding partners

Integrated Structure-Function Analysis:

Structural FeatureAnalytical TechniqueFunctional ImplicationValidation Method
Surface charge distributionElectrostatic potential mapping from crystal structureSalt interaction and solubilitySite-directed mutagenesis of charged residues
Flexible regionsNMR relaxation measurements, MD simulationsTemperature adaptationActivity assays at varying temperatures
Active site architectureCrystallography with substrate analogsSubstrate specificityEnzyme kinetics with variant substrates
Oligomerization stateSEC-MALS, analytical ultracentrifugationFunctional regulationActivity correlation with oligomeric state
Conformational changesFRET spectroscopy, HDX-MSAllosteric regulationMutagenesis of hinge regions

For Hlac_0350 specifically, correlation of structural features with the protein's ability to function in the extreme environment of Antarctica's Deep Lake would provide valuable insights into molecular adaptation mechanisms.

What are the most promising future research directions for understanding the role of Hlac_0350 in extremophilic adaptation?

The study of Hlac_0350 and related proteins from extremophiles represents a fertile ground for future research with several promising directions:

  • Comprehensive Functional Characterization:

    • Development of high-throughput screening methods to identify potential substrates or binding partners

    • Investigation of potential roles in membrane integrity under extreme conditions

    • Examination of possible stress-response functions specific to dual extreme environments

  • Structural Biology Advances:

    • Time-resolved structural studies to capture conformational dynamics under changing conditions

    • Neutron diffraction studies to map hydrogen bonding networks critical for cold adaptation

    • Integration of AlphaFold2 predictions with experimental validation to accelerate structural insights

  • Systems Biology Integration:

    • Multi-omics studies examining the role of Hlac_0350 in the context of global cellular responses to extreme conditions

    • Metabolic network analysis to position Hlac_0350 within adaptation pathways

    • Interactome mapping under different stress conditions to identify condition-specific protein complexes

  • Biotechnological Applications:

    • Engineering Hlac_0350 and understanding its properties for creating cold-active, salt-tolerant biocatalysts

    • Exploration of potential applications in bioprocessing under non-conventional conditions

    • Development of protein stabilization strategies based on extremophilic principles

  • Theoretical and Computational Advances:

    • Development of specialized force fields for molecular dynamics simulations of halophilic proteins

    • Machine learning approaches to predict extremophilic adaptations from sequence data

    • Quantum mechanical studies of unique bonding patterns in extremophilic proteins

These research directions will contribute not only to our fundamental understanding of protein adaptation to extreme environments but also potentially to biotechnological applications and astrobiological models for life under extreme conditions, as suggested by the research on H. lacusprofundi as a model organism for astrobiology .

What methodological challenges remain in studying proteins from polyextremophiles like Halorubrum lacusprofundi?

Despite significant advances in extremophile protein research, several methodological challenges persist when studying proteins like Hlac_0350 from polyextremophiles:

Technical Challenges in Experimental Approaches:

  • Expression and Purification Limitations:

    • Difficulty in obtaining sufficient quantities of properly folded protein

    • Challenges in maintaining protein stability during purification

    • Need for specialized equipment compatible with high salt concentrations

    • Development of expression hosts that better mimic native conditions

  • Structural Analysis Constraints:

    • Crystallization challenges under high-salt conditions

    • Salt interference with many biophysical techniques

    • Need for modified protocols for techniques like NMR and electron microscopy

    • Limited structural data on extremophilic proteins for comparative modeling

  • Functional Assay Development:

    • Difficulty in distinguishing salt effects on protein versus substrate/assay components

    • Temperature-dependent changes in buffer properties affecting measurements

    • Limited availability of standards for calibrating assays under extreme conditions

    • Need for specialized equipment capable of maintaining extreme conditions during measurements

Conceptual and Analytical Challenges:

  • Multi-factor Experimental Design:

    • Complexity of designing experiments that independently control multiple extreme parameters

    • Statistical challenges in analyzing multi-dimensional response surfaces

    • Difficulty in distinguishing additive from synergistic effects of multiple extreme conditions

  • Evolutionary Analysis Limitations:

    • Sparse sampling of extremophilic genomes across the tree of life

    • Limited functional annotation of extremophilic genes and proteins

    • Difficulty in distinguishing convergent evolution from common ancestry

    • Challenge of reconstructing ancient environmental conditions

  • Systems-Level Integration:

    • Limited availability of omics data from polyextremophiles

    • Challenges in cultivating organisms under truly native conditions

    • Difficulty in extrapolating from in vitro studies to in vivo function

    • Complexity of modeling cellular systems under multiple extreme conditions

Future Methodological Developments Needed:

  • Specialized Technological Adaptations:

    • High-salt compatible microfluidic systems for high-throughput screening

    • Cryo-EM sample preparation methods optimized for halophilic proteins

    • In situ structural biology techniques applicable in extreme environments

    • Sensors capable of monitoring protein behavior under multiple extreme conditions simultaneously

  • Computational Method Enhancements:

    • Force fields optimized for simulating proteins under extreme conditions

    • Integrative modeling approaches combining sparse experimental data

    • Machine learning methods for predicting extremophilic protein properties

    • Evolutionary algorithms to design experiments with optimal information content

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.