Recombinant Hamiltonella defensa subsp. Acyrthosiphon pisum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Structure and Function

The nuoK subunit is a component of the NADH-quinone oxidoreductase (Complex I) system, facilitating electron transfer from NADH to ubiquinone. In Hamiltonella defensa, this enzyme plays a central role in cellular respiration and energy production. The recombinant form is produced via heterologous expression in E. coli, often with a His-tag for purification .

Key Properties

PropertyDetail
Amino Acid SequenceMIPMQHGLILAAILFTLGLTGLLIRRNLIFmLISLEVMINSAALAWVVAGSHWGHPDGQI FYLLAITLAAAEASIGLALLLQLYRRHHTLNIDILSEMRG
Tag TypeN-terminal His-tag (exact location determined during production)
Storage BufferTris-based buffer with 50% glycerol
StabilityRecommended storage at -20°C (avoid repeated freeze-thaw cycles)

Experimental Uses

The recombinant nuoK protein is primarily employed in biochemical assays to study:

  1. Enzyme Function: Mechanistic studies of NADH dehydrogenase activity.

  2. Structural Analysis: Crystallography or cryo-EM to resolve subunit interactions.

  3. Immune Response: ELISA-based detection of antibodies against H. defensa in aphid immunity studies .

Role in H. defensa

Hamiltonella defensa is a defensive symbiont in aphids (Acyrthosiphon pisum), conferring resistance to parasitoids like Aphidius ervi. Its genome (2.1 Mb) retains pathogenicity-related genes, including type-3 secretion systems and toxin homologs, alongside metabolic genes like nuoK .

Key Genomic Insights

  • Horizontal Gene Transfer (HGT): The genome is enriched with mobile DNA (phages, insertion sequences), suggesting dynamic adaptation .

  • Auxotrophy: Dependent on Buchnera (primary symbiont) for essential amino acids, but retains genes for electron transport and cell wall synthesis .

Impact on Aphid-Predator Dynamics

While nuoK’s direct role in parasitoid resistance is unconfirmed, H. defensa’s presence alters aphid behaviors:

  • Reduced Evasion: Infected A. pisum exhibit fewer escape behaviors (e.g., dropping) when threatened by lady beetles .

  • Strain-Specific Protection: H. defensa strains vary in efficacy against parasitoids, influenced by phage-encoded toxins (e.g., APSE strains) .

Future Directions

Research gaps include:

  1. Functional Studies: Linking nuoK expression to metabolic efficiency or symbiosis stability.

  2. Evolutionary Trade-offs: Assessing costs of nuoK-mediated respiration on aphid fitness.

  3. Biotechnological Potential: Leveraging nuoK for biofuel production or antimicrobial target development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoK; HDEF_1612; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Target Names
nuoK
Target Protein Sequence
MIPMQHGLILAAILFTLGLTGLLIRRNLIFMLISLEVMINSAALAWVVAGSHWGHPDGQI FYLLAITLAAAEASIGLALLLQLYRRHHTLNIDILSEMRG
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. The process couples redox reactions with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) in Hamiltonella defensa?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the bacterial H+-translocating NADH:quinone oxidoreductase (NDH-1) complex in Hamiltonella defensa. This protein serves as a counterpart to the mitochondrial ND4L subunit and plays an essential role in energy metabolism . The nuoK subunit is characterized by its highly hydrophobic nature, consisting of three transmembrane segments (TM1-3) that span the cytoplasmic membrane . These transmembrane domains contain conserved charged residues, particularly glutamic acid residues in TM2 and TM3, that are crucial for facilitating proton translocation and energy coupling in the respiratory chain . In the context of H. defensa, a protective endosymbiont of aphids including Acyrthosiphon pisum, the nuoK protein contributes to the bacterium's energy metabolism despite its reduced genome size compared to free-living bacterial relatives .

How does the genetic structure of nuoK differ in H. defensa compared to other bacterial species?

The nuoK gene in Hamiltonella defensa represents an interesting case of gene retention during genome reduction. While H. defensa has undergone significant genome reduction (2.1 Mb) compared to its free-living relatives such as Yersinia and Serratia species (4.6-5.4 Mb), it has retained functional energy metabolism pathways including the NDH-1 complex .

The structural characteristics of the nuoK gene include:

FeatureH. defensa nuoKComparison to free-living bacteria
Gene sizeConserved core regionsGenerally smaller than in free-living relatives
Transmembrane domainsThree (TM1-3)Conserved number across bacterial species
Critical residuesTwo conserved glutamic acid residuesHighly conserved across bacterial species
Cytoplasmic loopContains critical arginine residuesFunctionally significant across species

Unlike obligate endosymbionts such as Buchnera that have lost many metabolic genes, H. defensa has maintained genes encoding functional respiratory complexes, including nuoK . This retention likely reflects the evolutionary history of H. defensa from pathogenic ancestors and its conditional rather than obligate relationship with its aphid host .

What role does nuoK play in the symbiotic relationship between H. defensa and A. pisum?

The nuoK subunit contributes significantly to the symbiotic relationship between Hamiltonella defensa and Acyrthosiphon pisum through its role in energy metabolism. Although H. defensa provides conditional benefits to its aphid host, primarily protection against parasitoid wasps, it must maintain efficient energy production to survive within the host environment .

The nuoK protein, as part of the NDH-1 complex, facilitates energy transduction through proton translocation, which generates the proton motive force necessary for ATP synthesis . This energy production is crucial for supporting H. defensa's various functions within the aphid host, including:

  • Maintenance of bacterial cellular processes despite genome reduction

  • Support for the expression of protective factors against parasitoid wasps

  • Sustaining the type-3 secretion systems and other pathogenicity-associated loci retained in the H. defensa genome

  • Enabling bacterial persistence in healthy aphids despite being derived from pathogenic ancestors

It's noteworthy that H. defensa is auxotrophic for 8 of the 10 essential amino acids and thus relies on Buchnera (the primary endosymbiont) for these nutrients . The energy metabolism facilitated by nuoK and other respiratory components allows H. defensa to utilize available resources efficiently within this dependent nutritional context.

How is recombinant H. defensa nuoK typically expressed for research purposes?

Recombinant expression of H. defensa nuoK typically follows protocols similar to those established for other prokaryotic membrane proteins. Based on established methodologies for similar proteins, the recommended expression approach involves:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, established protocolsRequires optimization for membrane protein
N-terminal His-tagFacilitates purification, minimal interferencePosition of tag critical for function
Full-length expressionMaintains structural integrityChallenging due to hydrophobic nature

The expression vector should contain the complete coding sequence (approximately 101 amino acids, based on analogous proteins) fused to an N-terminal His-tag to facilitate purification without disturbing the functional domains . Expression in E. coli offers a well-established system with high protein yields, though optimization is required to address the challenges associated with membrane protein expression .

Critical parameters for successful expression include:

  • Selection of appropriate E. coli strain (e.g., C41(DE3) or C43(DE3)) specialized for membrane protein expression

  • Induction at lower temperatures (16-25°C) to improve proper folding

  • Use of mild detergents for solubilization and purification

  • Inclusion of protease inhibitors during purification to prevent degradation

This expression strategy enables production of functional recombinant nuoK protein suitable for subsequent biochemical and structural studies .

What analytical methods are most effective for studying H. defensa nuoK structure and function?

Multiple analytical approaches are required to comprehensively study the structure and function of H. defensa nuoK, each providing complementary information:

Analytical MethodApplicationKey Information Obtained
Site-directed mutagenesisFunctional analysisImportance of specific residues (e.g., Glu-36, Glu-72)
Membrane potential assaysEnergy couplingProton translocation efficiency
Blue native PAGEComplex assemblyIntegration into NDH-1 complex
Circular dichroismSecondary structureα-helical content verification
Enzyme activity assaysCatalytic functionNADH:quinone oxidoreductase activity
Cryo-electron microscopyStructural analysisHigh-resolution structure of nuoK within NDH-1

For functional studies, site-directed mutagenesis of conserved residues, particularly the glutamic acid residues in TM2 and TM3 and the arginine residues in the cytoplasmic loop between TM1 and TM2, provides critical insights into the mechanism of proton translocation . Substitution of these residues with alanine or other amino acids can reveal their contribution to energy coupling and proton translocation capacity .

Complementary structural approaches such as cryo-electron microscopy can elucidate the positioning of nuoK within the larger NDH-1 complex and how conformational changes during catalysis might contribute to proton translocation. These methods, combined with biochemical assays measuring electron transfer and proton pumping activities, provide a comprehensive understanding of nuoK structure-function relationships.

How do mutations in conserved residues of H. defensa nuoK affect energy transduction?

Mutational analysis of conserved residues in H. defensa nuoK reveals critical insights into the mechanism of energy transduction. Based on studies of homologous proteins, mutations in key residues produce distinct functional consequences:

MutationLocationFunctional EffectImplications
Glu-36→AlaTM2Complete loss of NDH-1 activityEssential for proton translocation
Glu-72→AlaTM3Moderate reduction in activitySupporting role in proton pathway
Shifted Glu-36 (positions 32, 38, 39, 40)TM2Largely retained activityPositional flexibility within helix phase
Arg-25/Arg-26 double mutationCytoplasmic loop-1Drastic reduction in activityCritical for energy coupling

The complete loss of activity observed with the Glu-36→Ala mutation demonstrates that this residue is absolutely essential for proton translocation, likely serving as a proton donor/acceptor within the translocation pathway . In contrast, the moderate reduction in activity with the Glu-72→Ala mutation suggests this residue plays a supporting role rather than being directly involved in proton transfer .

Interestingly, shifting Glu-36 along TM2 to positions 32, 38, 39, or 40 largely preserves NDH-1 activity, indicating positional flexibility as long as the residue remains within the same helical phase . This suggests that the orientation of the carboxyl group within the membrane environment, rather than its exact position in the primary sequence, is critical for function.

The drastic effect of mutating the arginine residues (Arg-25/Arg-26) in the cytoplasmic loop between TM1 and TM2 indicates that this region may be involved in conformational changes that couple electron transfer to proton translocation, potentially interacting with other subunits of the NDH-1 complex .

How does the nuoK protein in H. defensa compare structurally to its counterparts in other bacterial endosymbionts?

Comparative analysis of nuoK across different bacterial endosymbionts reveals patterns of conservation and divergence that reflect evolutionary relationships and functional constraints:

OrganismGenome SizenuoK FeaturesConservation Level
H. defensa2.1 MbThree TM domains, conserved Glu residuesReference
Buchnera aphidicola~0.6 MbSome strains lack functional nuoKLow/absent
Free-living relatives (Yersinia, Serratia)4.6-5.4 MbAdditional regulatory elementsHigh core, divergent regulatory regions
Pathogenic bacteriaVariableSimilar core structure, virulence-associated modificationsModerate

H. defensa occupies an intermediate position in the spectrum of genome reduction among bacterial endosymbionts . Unlike obligate nutritional symbionts such as some Buchnera strains that have lost functional respiratory complexes, H. defensa has retained the complete NDH-1 complex, including nuoK . This retention likely reflects its conditional rather than obligate relationship with its host and its relatively recent transition to an endosymbiotic lifestyle from pathogenic ancestors .

Comparative genomic analyses indicate that while the core functional domains of nuoK are conserved in H. defensa, regulatory elements and protein-protein interaction domains may show greater divergence compared to free-living relatives, reflecting adaptation to the endosymbiotic lifestyle .

What role might nuoK play in the protective function of H. defensa against parasitoid wasps?

The contribution of nuoK to H. defensa's protective function against parasitoid wasps likely operates through indirect mechanisms related to energy metabolism support rather than direct involvement in defense mechanisms:

AspectMechanismContribution to Protection
Energy provisionATP generation through respiratory chainPowers type-3 secretion systems and toxin production
Metabolic supportMaintenance of redox balanceEnables sustained expression of protective factors
Host interactionSupport for cellular processesFacilitates persistence in healthy aphids
Evolutionary perspectiveRetained from pathogenic ancestorsMaintains core functions while adapting to symbiosis

H. defensa possesses numerous pathogenicity loci, including type-3 secretion systems and toxin homologs, which are hypothesized to contribute to its protective function against parasitoid wasps . These systems require substantial energy for their assembly and operation. As a component of the NDH-1 complex, nuoK contributes to energy transduction through proton translocation, generating the proton motive force necessary for ATP synthesis . This energy provision is crucial for powering the expression and operation of these protective systems.

The genome of H. defensa retains regulatory genes that likely control the timing of expression of these pathogenicity loci . The energy metabolism supported by nuoK and other respiratory components ensures sufficient ATP availability for these regulatory processes and the subsequent expression of protective factors.

Furthermore, the ability of H. defensa to persist in healthy aphids while providing conditional protection depends on maintaining a metabolic state that does not harm the host under normal conditions but can respond to parasitoid attack. The energy transduction function of nuoK contributes to this metabolic balance, enabling H. defensa to sustain its cellular processes while avoiding negative impacts on host fitness in the absence of parasitoids.

What experimental approaches can elucidate the proton translocation pathway involving nuoK in H. defensa?

Advanced experimental approaches to investigate the proton translocation pathway involving nuoK in H. defensa include:

Experimental ApproachApplicationExpected Outcomes
Hydrogen/deuterium exchange mass spectrometrySolvent accessibilityIdentification of water-accessible regions in nuoK
Molecular dynamics simulationsStructural dynamicsVisualization of potential proton pathways
Genetic suppressor analysisFunctional interactionsIdentification of compensatory mutations
pH-sensitive fluorescent probesReal-time monitoringDirect observation of proton movement
Cross-linking studies with other NDH-1 subunitsSubunit interactionsMapping of intermolecular contacts

Hydrogen/deuterium exchange mass spectrometry can identify solvent-accessible regions in the nuoK protein, potentially revealing entry and exit points for protons in the translocation pathway. This technique, combined with site-directed mutagenesis of conserved residues, can map the complete proton translocation pathway.

Molecular dynamics simulations offer insights into the structural dynamics of nuoK, revealing how conformational changes during catalysis might create transient water chains for proton transfer. These computational approaches can generate hypotheses about the precise pathway of proton movement that can be tested experimentally.

Genetic suppressor analysis, where secondary mutations are introduced to rescue the function of primary mutations in conserved residues, can identify functional interactions between different regions of nuoK or between nuoK and other subunits of the NDH-1 complex. This approach has been particularly valuable in understanding the interdependence of different components in proton translocation pathways .

The strategic incorporation of pH-sensitive fluorescent probes at key positions in the nuoK protein can enable real-time monitoring of proton movement during catalysis, providing direct evidence for the proposed translocation pathway. This approach requires careful consideration of probe attachment sites to avoid disrupting protein function.

How does the genomic context of nuoK in H. defensa influence its expression and function?

The genomic context of nuoK in Hamiltonella defensa provides critical insights into its regulation, expression, and functional integration within the NDH-1 complex:

Genomic FeatureCharacteristic in H. defensaFunctional Implication
Operon structurePart of nuo operonCoordinated expression with other NDH-1 subunits
Mobile genetic elementsGenome "littered" with mobile DNAPotential for horizontal gene transfer and regulation
Genome reduction2.1 Mb (reduced from 4.6-5.4 Mb)Retention indicates functional importance
Regulatory elementsRetained regulatory genesControlled expression in response to conditions

The H. defensa genome contains numerous mobile genetic elements, including phage-derived genes, plasmids, and insertion-sequence elements, highlighting its dynamic nature and the continued role of horizontal gene transfer in shaping it . This genomic plasticity may influence the expression of nuoK and other respiratory components through insertional effects or the introduction of new regulatory elements.

Despite significant genome reduction, H. defensa has retained regulatory genes that likely control the timing of expression of various functional systems . These regulatory mechanisms may modulate nuoK expression in response to changing conditions within the aphid host, such as nutrient availability or the presence of stressors like parasitoid attack.

The retention of nuoK and other components of the respiratory chain, despite genome reduction, underscores their importance for H. defensa's lifestyle as a facultative endosymbiont. Unlike obligate endosymbionts that may lose respiratory capacity, H. defensa maintains these functions to support its more complex lifestyle, including its conditional protective role .

What are the optimal conditions for expressing and purifying recombinant H. defensa nuoK protein?

Optimizing the expression and purification of recombinant H. defensa nuoK protein requires careful consideration of multiple parameters due to its hydrophobic nature and membrane localization:

ParameterOptimal ConditionRationale
Expression hostE. coli C41(DE3) or C43(DE3)Specialized for membrane protein expression
Temperature18°C post-inductionReduces inclusion body formation
Induction0.1-0.5 mM IPTGModerate induction prevents aggregation
Detergent selectionn-Dodecyl β-D-maltoside (DDM)Mild detergent preserves structure
Purification methodNickel affinity followed by size exclusionTwo-step purification ensures purity
Buffer pH7.5-8.0Mimics physiological conditions
Stabilizing additivesGlycerol (10%), specific lipidsEnhances protein stability

The expression of nuoK should be conducted in specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), which contain mutations that prevent the toxicity often associated with overexpression of membrane proteins . Lowering the post-induction temperature to 18°C slows protein synthesis, allowing more time for proper folding and membrane insertion.

For solubilization and purification, n-Dodecyl β-D-maltoside (DDM) offers a good balance between effective solubilization and preservation of protein structure and function. The purification process should utilize the N-terminal His-tag through nickel affinity chromatography, followed by size exclusion chromatography to remove aggregates and contaminants .

The purification buffer should include stabilizing additives such as glycerol (10%) to prevent aggregation and specific lipids (e.g., E. coli polar lipids) to maintain the native-like environment of the membrane protein. For functional studies, reconstitution into liposomes composed of E. coli polar lipids provides a membrane environment that supports proper folding and activity.

The yield of functional recombinant nuoK protein is typically in the range of 0.5-2 mg per liter of bacterial culture, though this can vary based on the specific expression and purification conditions employed.

How can researchers effectively study the integration of nuoK into the NDH-1 complex?

Investigating the integration of nuoK into the NDH-1 complex requires approaches that preserve native protein-protein interactions and assess functional assembly:

ApproachTechniqueInformation Gained
Co-expressionMulti-cistronic vectorsAssembly compatibility
Blue native PAGEElectrophoretic separationComplex integrity and size
Pull-down assaysAffinity chromatographyDirect interaction partners
Chemical cross-linkingMass spectrometryProximity mapping
Electron microscopySingle particle analysisStructural positioning
Functional reconstitutionProteoliposomesActivity verification

Co-expression strategies involve using multi-cistronic vectors to express nuoK alongside other NDH-1 subunits, particularly those with which it directly interacts. This approach enables assessment of assembly compatibility and can yield partially assembled subcomplexes for structural studies.

Blue native PAGE provides a relatively simple method to evaluate complex integrity by separating native protein complexes based on size. This technique can verify whether nuoK incorporates into higher-order structures consistent with assembled NDH-1 complex or subcomplexes.

Pull-down assays using tagged nuoK can identify direct interaction partners within the NDH-1 complex. By varying the detergent conditions, researchers can distinguish strong core interactions from weaker peripheral associations, providing insights into the assembly hierarchy.

Chemical cross-linking coupled with mass spectrometry offers powerful insights into the proximity relationships between nuoK and other subunits. This approach can map the three-dimensional arrangement of subunits within the complex, particularly when combined with computational modeling.

Advanced structural techniques such as cryo-electron microscopy with single particle analysis can visualize the positioning of nuoK within the larger NDH-1 complex at near-atomic resolution. This provides direct evidence of structural integration and can reveal conformational changes associated with different functional states.

Functional reconstitution into proteoliposomes represents the gold standard for verifying proper assembly. By measuring NADH:quinone oxidoreductase activity and proton pumping efficiency, researchers can confirm that nuoK has integrated into a functionally active complex.

What comparative genomics approaches can reveal evolutionary insights about nuoK in H. defensa?

Comparative genomics provides powerful tools for understanding the evolutionary history and functional constraints of nuoK in Hamiltonella defensa:

ApproachAnalysis MethodEvolutionary Insights
Phylogenetic analysisMaximum likelihood treesEvolutionary relationships
Selection pressure analysisdN/dS ratiosFunctional constraints
Synteny mappingGenome visualization toolsGene order conservation
Structural predictionHomology modelingConservation of functional domains
Horizontal gene transfer detectionCompositional bias analysisOrigin of genetic material
Pan-genome analysisCore vs. accessory genesDistribution across strains

Phylogenetic analysis of nuoK sequences from H. defensa and related bacteria can reveal evolutionary relationships and potential instances of horizontal gene transfer. This approach can place H. defensa nuoK in the context of its free-living relatives (Yersinia and Serratia species) and other endosymbionts, providing insights into how endosymbiosis has shaped its evolution .

Synteny mapping examines the conservation of gene order around nuoK across different bacterial species. In H. defensa, the genomic context of nuoK likely reflects its reduced genome size (2.1 Mb) compared to free-living relatives (4.6-5.4 Mb) . Changes in gene order can indicate genomic rearrangements associated with the transition to an endosymbiotic lifestyle.

Structural prediction through homology modeling can identify conserved structural features of nuoK despite sequence divergence. This approach can reveal whether the three transmembrane segments and critical charged residues maintain similar spatial arrangements across different bacterial species, indicating functional conservation despite sequence evolution.

Pan-genome analysis comparing nuoK across different strains of H. defensa can determine whether this gene belongs to the core genome (present in all strains) or the accessory genome (variable presence). As a component of the essential energy metabolism machinery, nuoK likely belongs to the core genome, though sequence variations may exist between strains adapted to different aphid hosts.

How can researchers investigate the role of nuoK in H. defensa's adaptation to the aphid host environment?

Investigating the role of nuoK in H. defensa's adaptation to the aphid host environment requires integrative approaches that connect molecular function to ecological context:

ApproachMethodologyAdaptation Insights
TranscriptomicsRNA-Seq under different conditionsExpression regulation
Experimental evolutionSerial passage in aphidsAdaptive mutations
Host switching experimentsTransfer between aphid speciesHost-specific adaptation
Metabolic modelingFlux balance analysisEnergetic contributions
Comparative analysisMultiple H. defensa strainsHost-specific variations
In vivo mutagenesisComplementation studiesFunctional verification

Transcriptomic analysis using RNA-Seq can reveal how nuoK expression changes under different host conditions, such as varying nutrient availability or during parasitoid attack. This approach can identify regulatory mechanisms that modulate energy metabolism in response to environmental cues within the aphid host.

Experimental evolution through serial passage of H. defensa in aphids, followed by genome sequencing, can identify adaptive mutations in nuoK or related genes that enhance bacterial fitness within the host environment. This approach can reveal ongoing adaptation processes that might not be detectable through comparative genomics alone.

Host switching experiments, where H. defensa is transferred between different aphid species or genotypes, can identify host-specific adaptation of energy metabolism components. Subsequent analysis of nuoK sequence and expression can reveal how this gene contributes to adaptation to different host environments.

Comparative analysis of nuoK sequences from H. defensa strains isolated from different aphid species can identify host-specific variations that might reflect adaptation to particular host environments. Correlation of these variations with differences in protection against parasitoids or bacterial persistence can provide insights into the ecological significance of nuoK adaptation.

In vivo mutagenesis using complementation studies, where mutant nuoK variants are introduced into H. defensa strains with the native gene knocked out, can verify the functional significance of specific adaptations. This approach, though technically challenging in endosymbionts, provides the most direct evidence for the role of nuoK in host adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.