Recombinant Hantaan virus Envelopment polyprotein (GP), partial

Shipped with Ice Packs
In Stock

Description

Introduction

Hantaan virus (HTNV) is a member of the Hantaviridae family and a causative agent of hemorrhagic fever with renal syndrome (HFRS) . Hantaviruses are enveloped viruses with a spherical structure, with the envelope membrane consisting of a bilayer of exterior lipids secreted from the Golgi complex . The mature hantavirus surface presents tetrameric assemblies of two glycoproteins, Gn and Gc, which are responsible for negotiating host cell entry and are key therapeutic targets . The M segment of the hantavirus genome encodes an envelop protein of 1,150 amino acids for glycoprotein . Recombinant Hantaan virus Envelopment polyprotein (GP), partial, is a form of the HTNV surface-displayed glycoprotein, Gn, that can elicit a neutralizing antibody response .

Structure and Function

Hantaviruses possess a tripartite genome consisting of small (S), medium (M), and large (L) segments . The M segment encodes a glycoprotein precursor (GPC) protein, which is then cleaved into the envelope-anchored glycoproteins Gn and Gc . These glycoproteins drive virus entry via receptor-mediated endocytosis and endosomal membrane fusion . The Gn and Gc glycoproteins form heterodimers that assemble into tetrameric spikes, which are the building blocks of the virus's surface lattice .

Recombinant Production and Characteristics

Recombinant Hantaan virus Envelopment polyprotein (GP), partial is produced in mammalian or baculovirus cells and is C-terminally 6xHis-tagged . The recombinant protein is available in liquid or lyophilized form with a purity greater than 90% as determined by SDS-PAGE . The molecular weight of the recombinant protein is around 52.7 kDa .

Immunogenicity and Neutralizing Antibody Response

A recombinant form of the Hantaan virus (HTNV) surface-displayed glycoprotein, Gn, elicits a neutralizing antibody response in rabbits . Monoclonal antibodies (mAbs) exhibiting neutralizing and non-neutralizing activity, termed mAb HTN-Gn1 and mAb nnHTN-Gn2, respectively, target spatially distinct epitopes at disparate sites of the N-terminal region of the HTNV Gn ectodomain .

Potential for Vaccine Development

Recombinant HTNV Gn is a potential target for vaccine development efforts and provides a structure-based platform for interrogating the molecular basis for the antibody-mediated targeting of the hantavirus surface . These findings may guide rational vaccine design approaches focused on targeting the hantavirus glycoprotein envelope .

Data Table

FeatureDescription
Protein NameRecombinant Hantaan virus Envelopment polyprotein (GP), partial
SourceMammalian or Baculovirus cell
TagC-terminal 6xHis-tagged
PurityGreater than 90% by SDS-PAGE
Molecular Weight~52.7 kDa
Biological OriginHantaan virus (strain 76-118) (Korean hemorrhagic fever virus)
Expression Region649-1105aa
ApplicationsResearch and development, vaccine design
Neutralizing Antibody ResponseElicits a neutralizing antibody response in rabbits

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
GP; Envelopment polyprotein; M polyprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
649-1134
Protein Length
Partial
Species
Hantaan virus (strain Hojo) (Hojo virus) (Korean hemorrhagic fever virus)
Target Names
GP
Target Protein Sequence
SETPLTPVWNDNAHGVGSIPMHTDLELDFSLTSSSKYTYRRKLTNPLEAQSIDLHIEIEE QTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSD CPGCGTGCTACGLYLDRLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHV KVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWRTSTCQFGDPGDIMSPRDKGFLCPEFP GSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLR DHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKA CDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFKCCHGEDCSPNGLHAAAPHLDKVNGI SEIENSKEYDDGAPQCGIKCWFVKSGEWISGIFSGNWIVLIVLCVFLLFSLVLLSILCPV RKHKKS
Uniprot No.

Target Background

Function
This protein forms homotetramers with glycoprotein C on the virion surface, mediating attachment to host cell receptors, including integrin beta3 (ITGB3). This attachment triggers virion internalization primarily via clathrin-dependent endocytosis. Subsequently, it promotes fusion between the viral and host endosomal membranes. Furthermore, it may dysregulate normal immune and endothelial cell responses through an ITAM motif. It also forms homotetramers with glycoprotein N on the virion surface, facilitating attachment to host cell receptors, including integrin beta3 (ITGB3), inducing virion internalization predominantly through clathrin-dependent endocytosis, and promoting fusion of the viral membrane with the host endosomal membrane following endocytosis.
Protein Families
Hantavirus envelope glycoprotein family
Subcellular Location
[Glycoprotein N]: Virion membrane. Host cell surface. Host Golgi apparatus membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Glycoprotein C]: Virion membrane. Host cell surface. Host Golgi apparatus membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the Hantaan virus Envelopment polyprotein (GP) and what is its role in viral infection?

The Hantaan virus (HTNV) Envelopment polyprotein (GP) is a precursor protein encoded by the M segment of the viral tripartite genome. This polyprotein is processed into two glycoproteins: the N-terminal Gn and C-terminal Gc, which are cleaved co-translationally by cellular signal peptidases . These glycoproteins form surface spikes on the viral envelope and play critical roles in virus assembly, budding, and host cell entry. Specifically, Gn forms homotetramers with Gc at the virion surface and mediates attachment to host cell receptors, including integrin beta3/ITGB3, which induces virion internalization predominantly through clathrin-dependent endocytosis . The glycoproteins are also responsible for promoting fusion of viral and cellular membranes, a crucial step in the viral infection process .

How do the structural features of HTNV Gn and Gc glycoproteins contribute to viral assembly?

The structural organization of HTNV glycoproteins reveals a sophisticated arrangement that facilitates viral assembly. Cryo-EM studies have demonstrated that viral spike complexes are formed by square-shaped Gn-Gc hetero-octamers composed of four Gn and four Gc molecules . The crystal structure of HTNV Gn shows a well-preserved α/β fold that is structurally conserved across the Hantaviridae family . In this arrangement, Gn forms the membrane-distal tetrameric lobes, while Gc occupies the volume underneath .

When expressed separately, Gn forms homo-tetrameric complexes and Gc forms homo-dimeric complexes, both in a concentration-dependent manner . When co-expressed, they interact in the Golgi apparatus to form Gn-Gc multimeric protein complexes of various sizes. These large glycoprotein multimers appear as multiple Gn viral spikes interconnected via Gc-Gc contacts, representing the initial assembly steps of the viral envelope within the Golgi organelle . This structural organization is essential for proper virion formation and subsequent viral infectivity.

What expression systems are most effective for producing recombinant HTNV GP for research purposes?

Mammalian cell expression systems have proven most effective for producing recombinant HTNV GP that maintains proper folding and post-translational modifications . These systems offer several advantages for researchers:

  • They provide appropriate cellular machinery for glycosylation and processing of viral envelope proteins.

  • They allow for the production of proteins with native-like conformations and functional properties.

  • They enable the expression of partial or complete GP sequences with high purity (>90% as determined by SDS-PAGE) .

For research applications requiring recombinant HTNV GP, expression in mammalian cells typically yields proteins with molecular weights of approximately 52.7 kDa for the partial form (residues 649-1105) . The recombinant proteins can be engineered with tags (commonly C-terminal 6xHis-tags) to facilitate purification and downstream applications. Researchers should consider that the choice of expression system significantly impacts protein quality and experimental outcomes when designing studies involving these viral glycoproteins .

How does the crystal structure of HTNV Gn contribute to our understanding of hantavirus assembly and fusion mechanisms?

The crystal structure of HTNV Gn provides crucial insights into the molecular architecture that underlies hantavirus assembly and membrane fusion. HTNV Gn crystallizes in the I422 space group with cell dimensions a=b=110.9Å, c=180.6Å, and angles α=β=γ=90.0°, yielding a high-resolution structure at 2.15Å . This structure reveals that HTNV Gn adopts a conserved α/β fold similar to that observed in genetically and geographically distant hantaviruses like Puumala virus, suggesting evolutionary preservation of this structural motif across the Hantaviridae family .

The structural analysis demonstrates that HTNV Gn undergoes significant conformational changes in response to acidic pH, forming potential homo-oligomerization interfaces. These pH-dependent structural transitions appear to be critical for exposing the hydrophobic fusion loops on Gc, which is necessary for the fusion of viral and cellular membranes during host cell entry . The crystal structure, combined with solution-state analysis and electron cryo-microscopy of acidified hantavirus, has enabled researchers to propose models for endosome-induced reorganization of the hantaviral glycoprotein lattice—providing a molecular rationale for the fusion process .

The Ramachandran statistics for the HTNV Gn structure show excellent quality, with 96.04% of residues in preferred regions and 3.96% in allowed regions, with no outliers . This high-quality structural data serves as a foundation for structure-based drug design and vaccine development efforts targeting hantavirus infection.

What methodological approaches can be used to study HTNV glycoprotein interactions in living cells?

Quantitative fluorescence microscopy techniques have emerged as powerful tools for investigating HTNV glycoprotein interactions in living cells. Specific methods that have yielded significant insights include:

  • Number and Brightness (N&B) Analysis: This technique allows researchers to monitor the oligomerization state of fluorescently tagged proteins in different subcellular compartments. Studies have shown that HTNV Gn forms monomers at low concentrations and tetramers at higher concentrations, while HTNV Gc exhibits multimerization states between monomers and dimers across various concentration ranges .

  • Fluorescence Fluctuation Spectroscopy: This approach enables quantification of protein-protein interactions based on the fluctuations in fluorescence intensity as molecules move through a small observation volume. By applying this technique, researchers have determined that when expressed separately, Gn and Gc form homo-tetrameric and homo-dimeric complexes, respectively .

  • Bi-directional Expression Vectors: These constructs allow monitoring the oligomerization of one protein as a function of the concentration of another, providing insights into hetero-interactions between Gn and Gc .

When implementing these methodologies, researchers should employ various labeling schemes to minimize the influence of fluorescent tags on protein behavior. Site-directed mutations or deletion mutants can be used to validate the specificity of homotypic interactions . These approaches collectively provide direct visualization of viral assembly processes in the physiological context of living cells, offering advantages over traditional biochemical assays performed with virion extracts.

How do pH changes affect HTNV glycoprotein conformation and viral fusion activity?

pH changes play a critical role in triggering conformational changes in HTNV glycoproteins that are essential for viral fusion activity. Structural studies have revealed that acidic pH conditions, similar to those encountered in endosomes during viral entry, induce significant rearrangements in the HTNV Gn structure . These conformational changes result in the formation of homo-oligomerization interfaces that facilitate viral fusion with host cell membranes.

The pH-dependent structural transitions involve:

  • Reorganization of the hantaviral glycoprotein lattice

  • Exposure of previously buried hydrophobic fusion loops on the Gc protein

  • Formation of new protein-protein interfaces that stabilize fusion-competent conformations

These structural rearrangements provide the molecular basis for the fusion of viral and cellular membranes, a process required for releasing the viral genome into the host cell cytoplasm . The ability to undergo these pH-triggered conformational changes is conserved across different hantavirus species, highlighting their fundamental importance to the viral life cycle.

When designing experiments to study these pH-dependent effects, researchers should consider using buffer systems that accurately mimic endosomal acidification pathways and employ techniques such as circular dichroism spectroscopy, intrinsic fluorescence measurements, or hydrogen-deuterium exchange mass spectrometry to monitor structural changes in response to pH variations.

What are the optimal storage and reconstitution conditions for recombinant HTNV GP to maintain its structural integrity?

Optimal storage and reconstitution of recombinant HTNV GP is critical for preserving its structural integrity and functional properties. Based on established protocols, the following conditions are recommended:

For liquid formulations:

  • Store in Tris/PBS-based buffer containing 5-50% glycerol

  • Maintain at -20°C to -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles by preparing working aliquots

For lyophilized powder formulations:

  • The buffer before lyophilization should be Tris/PBS-based with 6% Trehalose, pH 8.0

  • Store the lyophilized powder at -20°C to -80°C

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimal: 50%) to prevent freeze-damage

  • Prepare multiple small-volume aliquots for single use

Stability guidelines:

  • Protein in liquid form is generally stable for up to 6 months at -20°C to -80°C

  • Lyophilized protein can maintain stability for up to 12 months at -20°C to -80°C

  • Working aliquots can be stored at 4°C for up to one week

Following these protocols will help ensure that the recombinant protein maintains its native conformation and activity for research applications, particularly for structural studies and functional assays involving protein-protein interactions.

What quantification methods are most appropriate for analyzing HTNV GP protein-protein interactions?

Several quantification methods have proven effective for analyzing HTNV GP protein-protein interactions, each with specific advantages depending on the research question:

  • Fluorescence Fluctuation Spectroscopy (FFS): This technique allows quantification of protein-protein interactions based on fluctuations in fluorescence intensity as molecules move through a defined observation volume. FFS has been successfully applied to monitor interactions leading to oligomeric spike complex formation in living cells .

  • Number and Brightness (N&B) Analysis: This approach enables determination of the oligomerization state of fluorescently tagged proteins in different subcellular compartments. Studies have employed N&B analysis to quantify HTNV Gn and Gc homo-multimerization over large concentration ranges in different cell models .

  • Bi-directional Expression Systems: These systems allow monitoring the oligomerization of one protein as a function of the concentration of another, providing insights into hetero-interactions between Gn and Gc glycoproteins .

For in vitro studies, additional methods include:

  • Surface Plasmon Resonance (SPR): Provides real-time, label-free measurement of binding kinetics and affinity constants.

  • Isothermal Titration Calorimetry (ITC): Offers direct measurement of thermodynamic parameters associated with protein-protein interactions.

  • Analytical Ultracentrifugation: Enables determination of the stoichiometry and strength of protein complexes in solution.

When selecting a quantification method, researchers should consider factors such as the need for in vivo versus in vitro measurements, sensitivity requirements, and whether information on binding kinetics or steady-state interactions is more relevant to their research question.

How can site-directed mutagenesis be used to investigate functional domains in HTNV glycoproteins?

Site-directed mutagenesis represents a powerful approach for investigating the functional domains of HTNV glycoproteins. This technique allows researchers to systematically modify specific amino acid residues and evaluate their impact on protein structure, oligomerization, and function. Based on existing research, the following methodological framework is recommended:

  • Target Selection Strategy:

    • Focus on conserved residues identified through sequence alignment across hantavirus species

    • Target amino acids at predicted protein-protein interfaces based on crystal structures

    • Prioritize residues in regions known to undergo conformational changes in response to pH

    • Select amino acids in predicted fusion peptides or receptor-binding domains

  • Mutation Design Principles:

    • Conservative substitutions (e.g., Leu→Ile) to assess the importance of specific chemical properties

    • Charge reversals (e.g., Asp→Lys) to disrupt electrostatic interactions

    • Alanine scanning to eliminate side-chain contributions while maintaining backbone structure

    • Deletion mutants to evaluate the importance of specific domains

  • Functional Assay Selection:

    • Fluorescence microscopy to assess subcellular localization and co-localization with partner proteins

    • Number and brightness analysis to quantify changes in oligomerization behavior

    • Cell fusion assays to evaluate the impact on fusion activity

    • Immunoprecipitation studies to assess protein-protein interaction capabilities

  • Controls and Validation:

    • Include wild-type proteins as positive controls

    • Generate multiple mutations of the same residue to different amino acids

    • Confirm protein expression and stability before interpreting functional data

    • Verify that mutations do not cause global protein misfolding using circular dichroism

This methodological approach has successfully demonstrated the specificity of homotypic interactions between Gn and Gc glycoproteins and has helped identify critical residues involved in pH-dependent conformational changes . By systematically applying site-directed mutagenesis, researchers can map functional domains within HTNV glycoproteins and gain insights into the molecular mechanisms underlying viral assembly and fusion.

What are the main challenges in producing functionally active recombinant HTNV GP, and how can they be addressed?

Producing functionally active recombinant HTNV GP presents several technical challenges that researchers must overcome. These challenges and their potential solutions include:

  • Proper Protein Folding and Glycosylation:

    • Challenge: HTNV glycoproteins require complex post-translational modifications and disulfide bond formation for correct folding.

    • Solution: Use mammalian expression systems (preferably CHO-K1 or HEK293 cells) that provide appropriate cellular machinery for glycosylation and proper folding . Avoid bacterial expression systems for full-length or complex domains of viral glycoproteins.

  • Protein Solubility and Aggregation:

    • Challenge: Viral envelope proteins often contain hydrophobic regions that can lead to aggregation.

    • Solution: Optimize buffer conditions (pH, ionic strength, additives like glycerol or Trehalose) . Consider expressing soluble ectodomains rather than full-length proteins with transmembrane domains when appropriate for the research question.

  • Expression Level Optimization:

    • Challenge: Achieving high expression levels without triggering cellular stress responses.

    • Solution: Employ codon-optimized sequences, use strong but regulatable promoters, and optimize transfection conditions. Consider stable cell line development for consistent expression.

  • Protein Purification While Maintaining Activity:

    • Challenge: Purifying the protein without disrupting its native conformation.

    • Solution: Use affinity tags that minimize interference with protein function (e.g., C-terminal His-tags) . Employ gentle elution conditions and include stabilizing agents in purification buffers.

  • Functional Validation:

    • Challenge: Confirming that recombinant proteins retain native-like activities.

    • Solution: Implement multiple complementary functional assays, including binding studies, oligomerization analysis, and where possible, cell fusion assays. Compare the behavior of recombinant proteins with virus-derived material.

By addressing these challenges methodically, researchers can produce high-quality recombinant HTNV GP with greater than 90% purity as determined by SDS-PAGE , suitable for structural studies and functional investigations.

How can researchers optimize fluorescence microscopy protocols for studying HTNV glycoprotein dynamics in living cells?

Optimizing fluorescence microscopy protocols is essential for accurately studying HTNV glycoprotein dynamics in living cells. Based on successful implementations in the literature, the following methodological refinements are recommended:

  • Fluorescent Protein Selection and Labeling Strategy:

    • Use monomeric fluorescent proteins (e.g., mEGFP) to minimize tag-induced oligomerization

    • Position tags to minimize interference with protein function and trafficking

    • Implement various labeling schemes to verify that observed interactions are not artifacts of the fluorescent tags

    • Consider split fluorescent protein approaches for studying protein-protein interactions

  • Imaging Parameters Optimization:

    • Adjust laser power to minimize photobleaching while maintaining adequate signal-to-noise ratio

    • Select appropriate exposure times to capture dynamics while avoiding motion blur

    • Optimize pixel size and sampling frequency based on the expected diffusion coefficients of the proteins

    • Use environmental chambers to maintain physiological conditions (temperature, CO₂) during imaging

  • Quantitative Analysis Approaches:

    • Implement number and brightness (N&B) analysis to determine oligomerization states in different subcellular compartments

    • Use fluorescence fluctuation spectroscopy to quantify protein-protein interactions

    • Apply appropriate background correction and photobleaching compensation algorithms

    • Analyze data as a function of protein concentration to distinguish concentration-dependent effects

  • Controls and Validation:

    • Include monomeric and oligomeric control proteins to calibrate brightness measurements

    • Perform parallel experiments with non-interacting fluorescent proteins to establish baseline measurements

    • Use site-directed mutations or deletion mutants to confirm interaction specificity

    • Combine live-cell imaging with complementary biochemical approaches for validation

These optimizations have enabled researchers to observe clear indications of Gn-Gc interactions and the formation of multimeric protein complexes of different sizes in the Golgi apparatus of living cells , providing direct evidence for the initial assembly steps of the viral envelope within this organelle.

What experimental designs can help distinguish between different models of HTNV glycoprotein assembly?

Multiple models have been proposed for HTNV glycoprotein assembly, and distinguishing between these models requires carefully designed experimental approaches. The following experimental designs can help researchers evaluate competing assembly hypotheses:

  • Concentration-Dependent Oligomerization Analysis:

    • Approach: Express fluorescently tagged Gn and Gc at varying concentrations and quantify their oligomerization states using number and brightness analysis .

    • Expected Outcome: This approach has revealed that Gn forms tetramers and Gc forms dimers when expressed separately, providing support for specific assembly models .

  • Bi-Directional Expression Systems:

    • Approach: Monitor the oligomerization of one glycoprotein while systematically varying the concentration of its partner protein .

    • Rationale: This design allows direct observation of how interactions between Gn and Gc influence their respective oligomerization behaviors.

  • Domain Mapping Through Truncation and Mutation Analysis:

    • Approach: Generate a series of deletion mutants and point mutations in specific domains of Gn and Gc, then evaluate their impact on protein-protein interactions .

    • Analysis: This can identify critical interfaces required for homo- and hetero-oligomerization.

  • Subcellular Compartment-Specific Analysis:

    • Approach: Compare protein-protein interactions in different cellular compartments (ER, Golgi, plasma membrane) to determine where specific assembly events occur .

    • Expected Outcome: This has identified the Golgi apparatus as the site where large Gn-Gc heteromultimers form, providing evidence for specific assembly pathways .

  • Time-Resolved Imaging of Assembly Process:

    • Approach: Use pulse-chase labeling or photoactivatable fluorescent proteins to track the temporal sequence of assembly events.

    • Analysis: This can distinguish between concurrent and sequential assembly models.

These experimental approaches have collectively provided support for a model in which viral spikes are formed via the clustering of hetero-dimers of Gn and Gc glycoproteins, with the initial assembly steps occurring in the Golgi apparatus of infected cells . By implementing multiple complementary experimental designs, researchers can build a comprehensive understanding of the HTNV glycoprotein assembly process.

How can structural information about HTNV GP be leveraged for vaccine development and antiviral drug design?

The detailed structural information available for HTNV GP provides valuable foundations for rational vaccine development and antiviral drug design strategies:

  • Subunit Vaccine Development:

    • The crystal structure of HTNV Gn reveals conserved epitopes that could serve as targets for neutralizing antibodies .

    • Researchers can design stable, recombinant GP fragments that present these epitopes in their native conformation.

    • Structure-guided immunogen design can focus on regions that undergo conformational changes during viral entry, potentially generating antibodies that block these transitions.

  • Antiviral Drug Development:

    • The identified pH-dependent conformational changes in HTNV Gn provide specific molecular targets for small-molecule inhibitors .

    • Compounds that stabilize pre-fusion conformations or prevent the exposure of fusion loops could effectively block viral entry.

    • The Gn-Gc interaction interfaces represent additional targets for designing peptidomimetics or small molecules that disrupt viral assembly.

  • Structure-Based Screening Approaches:

    • Virtual screening against binding pockets identified in the HTNV Gn crystal structure can identify lead compounds for further optimization.

    • Fragment-based drug discovery using the structural data can generate novel inhibitors targeting specific functional domains.

    • Protein-protein interaction hotspots at the Gn-Gc interface can be targeted with designed peptides or small molecules.

  • Broad-Spectrum Antiviral Strategies:

    • Structural conservation across hantavirus species suggests that targeting common features could yield broad-spectrum antivirals .

    • Comparative analysis of multiple hantavirus GP structures can identify conserved druggable sites.

These structure-based approaches offer significant advantages over traditional screening methods, potentially accelerating the development of effective countermeasures against hantavirus infections. The availability of high-resolution structural data (2.15Å for HTNV Gn) provides the precision needed for structure-based drug design efforts targeting this emerging pathogen.

What are the current knowledge gaps in understanding HTNV glycoprotein functions, and how might they be addressed?

Despite significant advances in characterizing HTNV glycoproteins, several important knowledge gaps remain. Addressing these gaps will require innovative experimental approaches:

  • Receptor Recognition Mechanisms:

    • Knowledge Gap: The specific molecular interactions between HTNV Gn/Gc and cellular receptors remain incompletely understood.

    • Approach: Cryo-EM studies of GP-receptor complexes, combined with targeted mutagenesis and binding assays, could elucidate these interactions.

  • Membrane Fusion Mechanisms:

    • Knowledge Gap: While pH-dependent conformational changes have been observed , the precise sequence of events leading to membrane fusion is not fully characterized.

    • Approach: Time-resolved structural studies using hydrogen-deuterium exchange mass spectrometry or single-molecule FRET could capture intermediate conformations during the fusion process.

  • Assembly Pathway Dynamics:

    • Knowledge Gap: The kinetics and regulation of viral assembly in the Golgi apparatus require further elucidation.

    • Approach: Advanced live-cell imaging techniques with improved temporal resolution, combined with systems biology approaches modeling assembly pathways.

  • Host Factors Involved in GP Maturation:

    • Knowledge Gap: Cellular proteins that assist in GP folding, trafficking, and assembly are incompletely identified.

    • Approach: Proximity labeling techniques (BioID, APEX) coupled with mass spectrometry could identify host factors in close proximity to viral GPs during different stages of maturation.

  • Strain-Specific Functional Differences:

    • Knowledge Gap: Functional differences between glycoproteins from different hantavirus strains are not fully characterized.

    • Approach: Comparative functional studies of recombinant GPs from multiple strains, focusing on properties like pH sensitivity, receptor usage, and fusion kinetics.

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, advanced imaging, biochemistry, and virology. The integration of these methodologies promises to yield a more comprehensive understanding of HTNV glycoprotein functions and their roles in viral pathogenesis.

How can comparative studies of different hantavirus glycoproteins enhance our understanding of virus evolution and host adaptation?

Comparative studies of glycoproteins from different hantavirus species provide valuable insights into viral evolution and host adaptation mechanisms. These approaches can be particularly powerful when implemented with the following methodological considerations:

  • Structural Comparison Across Hantavirus Species:

    • The structural conservation between HTNV Gn and Puumala virus Gn, despite genetic and geographic distance, suggests that the observed α/β fold is evolutionarily preserved across the Hantaviridae family .

    • Systematic comparison of crystal structures can identify both conserved functional domains and variable regions that may contribute to host specificity.

    • Mapping sequence diversity onto structural models can reveal selection pressures on different protein regions.

  • Functional Comparison of Glycoprotein Properties:

    • Quantitative analysis of multimerization behavior across virus strains (e.g., PUUV vs. HTNV) has revealed both similarities and differences in how glycoproteins interact .

    • Comparative studies of subcellular localization preferences (e.g., PUUV GPs localize to the Golgi, while HTNV GPs can localize to the ER when expressed separately) provide insights into virus-specific assembly pathways .

    • Assessing pH sensitivity of different hantavirus glycoproteins can reveal adaptations to different cellular entry pathways.

  • Host Range Determinants:

    • Identifying glycoprotein residues that differ between hantaviruses with different host specificities can reveal host adaptation mechanisms.

    • Recombinant proteins with chimeric domains from different hantavirus species can be used to map determinants of host cell tropism.

    • Comparing receptor usage and binding affinities across species can illuminate evolutionary adaptations to different hosts.

  • Phylogenetic Analysis Combined with Functional Data:

    • Integrating functional data with phylogenetic analysis can reveal how functional properties have evolved across the hantavirus family.

    • Ancestral sequence reconstruction and expression of predicted ancestral glycoproteins can provide insights into evolutionary trajectories.

These comparative approaches have already revealed that while some properties (like the formation of tetrameric Gn and dimeric Gc) are conserved across hantavirus species, others (like subcellular localization preferences) can vary . Continued comparative studies will enhance our understanding of how these viruses evolve and adapt to different hosts, potentially informing strategies for predicting and preventing future outbreaks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.