Recombinant Hapalemur griseus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Evolutionary Adaptations

Comparative studies of MT-CO2 across primates reveal:

  • Accelerated amino acid substitutions in higher primates, potentially linked to altered cytochrome c binding .

  • Structural divergence in Hapalemur griseus compared to humans, with 12 unique residues near the CuA center .

Cyanide Resistance Mechanisms

Hapalemur griseus consumes bamboo containing cyanide levels lethal to other mammals. Recombinant MT-CO2 enables investigations into:

  • Cyanide detoxification pathways, as the enzyme’s redox centers may mitigate cyanide inhibition .

  • Substrate-binding specificity changes that reduce cyanide affinity .

Production and Quality Control

The recombinant protein is produced via:

  1. Cloning: Full-length MT-CO2 gene insertion into bacterial vectors .

  2. Expression: Induction with IPTG in E. coli BL21 strains .

  3. Purification: Nickel-affinity chromatography leveraging the His tag .

ParameterValue
Purity>95% (SDS-PAGE)
Endotoxin Levels<1.0 EU/μg (LAL assay)
Reconstitution0.1–1.0 mg/mL in PBS (pH 7.4)

Comparative Analysis with Human MT-CO2

FeatureHapalemur griseus MT-CO2Human MT-CO2
Amino Acid Length227 aa227 aa
Sequence Identity89% (vs. human) Reference (NP_000082.1)
Key DivergenceLeu204 (His in humans) His204 critical for CuA stability

This divergence suggests species-specific adaptations in cytochrome c binding .

Research Implications

  • Drug Development: MT-CO2 mutations are linked to mitochondrial disorders (e.g., Leigh syndrome). Recombinant variants aid in screening therapeutic compounds .

  • Primate Evolution: Accelerated evolution in MT-CO2 correlates with dietary shifts toward cyanogenic plants in lemurs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Hapalemur griseus (Gray gentle lemur) (Eastern lesser bamboo lemur)
Target Names
Target Protein Sequence
MAYPVQLGFQDAASPIMEELLYFHDHTLMIMFLISSLVLYIISLMLTTELMHTNTMDAQE VETVWTILPAAILILIALPSLRILYMMDEITTPSLTLKTMGHQWYWSYEYTDYENLCFDS YMVPSSDLKPGELRLLEVDNRIVLPTELSIRMLISSEDVLHSWAVPSLGVKTDAIPGRLN QATLMASRPGIYYGQCSEICGANHSFMPIVLELVPLKHFEEWLLSML
Uniprot No.

Target Background

Function

Recombinant Hapalemur griseus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, which drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) composed of heme A3 and copper B (CuB). The BNC utilizes four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what role does it play in cellular respiration?

MT-CO2 (Cytochrome c Oxidase Subunit 2) is one of the essential subunits of cytochrome c oxidase (Complex IV), which catalyzes the final step in the mitochondrial electron transfer chain. As a terminal complex, it facilitates the transfer of electrons from ferrocytochrome c to molecular oxygen, contributing significantly to energy production through oxidative phosphorylation. This process is critical for cellular respiration and ATP generation . The MT-CO2 subunit is encoded by mitochondrial DNA and serves as one of the three mitochondrially-encoded subunits among the thirteen total subunits that comprise the complete cytochrome c oxidase complex .

How does recombinant MT-CO2 differ from native MT-CO2 in experimental applications?

Recombinant MT-CO2 is expressed in heterologous systems (commonly E. coli) and typically contains additional elements such as affinity tags (e.g., His-tag) that are not present in the native protein. While these modifications facilitate purification and detection, they may potentially influence protein folding, interaction capabilities, and functional characteristics in certain experimental contexts.

The recombinant Hapalemur griseus MT-CO2 is produced with an N-terminal His-tag fusion and expressed in E. coli expression systems. This approach enables efficient purification through affinity chromatography but requires careful consideration when interpreting results, particularly in structural or interaction studies where the tag might interfere with native conformations . Researchers should consider tag removal through proteolytic cleavage for applications requiring strict native-like conditions.

What are the optimal storage and handling conditions for recombinant MT-CO2?

Recombinant MT-CO2 requires specific storage and handling protocols to maintain structural integrity and functional activity. For long-term storage, the protein should be maintained at -20°C to -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise protein stability. The lyophilized powder form provides greater stability during storage .

For reconstitution, the following protocol is recommended:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%)

  • Aliquot for long-term storage at -20°C/-80°C

  • For working solutions, store aliquots at 4°C for up to one week

The protein is typically stable in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain its native conformation and activity during storage and experimental manipulation .

How can researchers effectively validate the purity and activity of recombinant MT-CO2?

Validating both the purity and functional activity of recombinant MT-CO2 requires a multi-step analytical approach:

Validation ParameterRecommended MethodExpected Outcome
Purity AssessmentSDS-PAGESingle band at expected molecular weight (~25 kDa plus tag) with >90% purity
Identity ConfirmationWestern Blot using anti-MT-CO2 or anti-His antibodiesSpecific binding at expected molecular weight
Secondary StructureCircular Dichroism (CD) SpectroscopyCharacteristic spectrum consistent with predicted secondary structure elements
Functional ActivityCytochrome c Oxidase Activity AssayCatalytic electron transfer activity when incorporated into appropriate lipid environment

For complex functional studies, researchers should consider reconstituting the protein into liposomes or nanodiscs to provide the membrane environment necessary for proper folding and activity. The characteristic cytochrome c oxidase activity can then be measured spectrophotometrically by monitoring the oxidation of reduced cytochrome c at 550 nm .

What experimental systems are suitable for studying MT-CO2 function?

Multiple experimental systems can be employed to investigate MT-CO2 function, each with distinct advantages depending on research objectives:

  • Reconstituted Proteoliposomes: Ideal for studying the biophysical properties and electron transfer kinetics in a controlled membrane environment

  • Cell-Free Expression Systems: Useful for studying protein synthesis, folding, and initial assembly stages without cellular interference

  • RNA Interference Models: Effective for studying the consequences of MT-CO2 deficiency on assembly and respiratory function, as demonstrated in models where suppression of related subunits led to loss of cytochrome c oxidase complex assembly and reduced respiration

  • Patient-Derived Cell Lines: Valuable for studying MT-CO2 mutations associated with cytochrome c oxidase deficiency disorders, offering insights into pathophysiological mechanisms

  • Yeast Models: Advantageous for functional complementation studies to assess the impact of specific mutations on respiratory capacity

Each system provides unique insights, and researchers should select based on specific questions regarding structure, assembly, function, or disease relevance.

How does MT-CO2 contribute to the assembly and stability of the cytochrome c oxidase complex?

MT-CO2 plays a critical role in the assembly and stability of the cytochrome c oxidase complex through specific structural interactions with other subunits. Research using RNA interference models has demonstrated that suppression of related subunits (such as COX IV) results in failed assembly of the entire complex, suggesting a sequential and interdependent assembly process .

The assembly pathway involves:

  • Initial formation of subassemblies coordinated by specific assembly factors

  • Integration of mitochondrially-encoded subunits (including MT-CO2) into the inner mitochondrial membrane

  • Subsequent association with nuclear-encoded subunits

  • Final maturation through incorporation of metal cofactors and prosthetic groups

Advanced analytical approaches to study this process include:

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to visualize assembly intermediates

  • Pulse-chase experiments with radioactive amino acids to track the temporal sequence of assembly

  • Proximity labeling techniques to identify transient protein-protein interactions during assembly

  • Cryo-electron microscopy to resolve structural details of assembly intermediates

Understanding these assembly mechanisms has significant implications for developing therapeutic strategies for cytochrome c oxidase deficiency disorders.

What experimental approaches can elucidate the evolutionary significance of MT-CO2 sequence variations across primate species?

Investigating the evolutionary significance of MT-CO2 sequence variations requires integrated comparative genomic and functional approaches:

  • Phylogenetic Analysis: Comparing MT-CO2 sequences across primate species, including Hapalemur griseus, to identify conserved domains and species-specific variations

  • Positive Selection Analysis: Calculating dN/dS ratios (non-synonymous to synonymous substitution rates) to identify regions under selective pressure, which may indicate functional adaptation

  • Structural Modeling: Using homology modeling and molecular dynamics simulations to predict how species-specific variations affect protein structure and function

  • Functional Complementation: Expressing MT-CO2 variants from different species in model systems deficient in endogenous MT-CO2 to assess functional differences

  • Environmental Adaptation Correlation: Correlating sequence variations with ecological niches, particularly focusing on how MT-CO2 variations might relate to metabolic adaptations in response to environmental factors such as altitude, temperature, or diet

This multifaceted approach can reveal how MT-CO2 has evolved specifically in Hapalemur griseus compared to other primates, potentially providing insights into unique metabolic adaptations in this species.

How can researchers effectively study the interaction between MT-CO2 and other components of the electron transport chain?

Studying MT-CO2 interactions within the electron transport chain requires specialized techniques to capture both stable and transient interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against MT-CO2 or its binding partners to isolate intact complexes

  • Crosslinking Mass Spectrometry (XL-MS): Employing chemical crosslinkers followed by mass spectrometry to identify interaction interfaces between MT-CO2 and other proteins

  • Surface Plasmon Resonance (SPR): Measuring binding kinetics between purified MT-CO2 and potential interaction partners

  • Förster Resonance Energy Transfer (FRET): Tagging MT-CO2 and interaction partners with fluorescent probes to detect proximity and interaction dynamics in living systems

  • Cryo-Electron Microscopy: Resolving high-resolution structures of MT-CO2 within the assembled cytochrome c oxidase complex to identify critical interaction interfaces

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifying regions of MT-CO2 that undergo conformational changes upon interaction with binding partners

These methods can provide complementary information about both the structural and dynamic aspects of MT-CO2 interactions within the respiratory chain.

What are common challenges in expressing and purifying recombinant MT-CO2, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant MT-CO2:

ChallengePotential CauseSolution Strategy
Low expression yieldCodon bias in E. coliUse codon-optimized gene or specialized E. coli strains (Rosetta, CodonPlus)
Inclusion body formationImproper folding of membrane protein in cytoplasmLower induction temperature (16-18°C); use fusion partners (SUMO, MBP); add mild detergents during lysis
Protein aggregation after purificationHydrophobic regions exposed to aqueous environmentInclude appropriate detergents or lipids in purification buffers; use amphipols or nanodiscs for stabilization
Poor solubilityHydrophobic nature of transmembrane regionsOptimize buffer conditions with screening approaches; include glycerol or mild solubilizing agents
Tag interference with functionHis-tag affecting protein conformationConsider tag removal through proteolytic cleavage for functional studies

A systematic approach to optimization, including expression condition screening and buffer optimization, can significantly improve yield and quality of recombinant MT-CO2 preparations .

How should researchers interpret experimental data when studying MT-CO2 in the context of cytochrome c oxidase deficiency?

When interpreting experimental data related to MT-CO2 in cytochrome c oxidase deficiency research, several considerations are critical:

  • Genotype-Phenotype Correlation: Determine whether observed functional defects correlate with specific mutations in MT-CO2 or related genes, recognizing that cytochrome c oxidase deficiency can result from mutations in multiple genes

  • Tissue-Specific Effects: Consider that cytochrome c oxidase deficiency can affect different tissues variably (skeletal muscles, heart, brain, liver), so cellular models should be chosen appropriately to represent the tissue of interest

  • Assembly vs. Function: Distinguish between defects in complex assembly versus catalytic dysfunction, as these represent distinct molecular mechanisms with different therapeutic implications

  • Threshold Effects: Interpret partial deficiencies carefully, as cytochrome c oxidase typically must be reduced below a critical threshold (often 10-30% of normal activity) before clinical or biochemical phenotypes manifest

  • Secondary Adaptations: Consider compensatory mechanisms that may mask primary defects, such as mitochondrial proliferation or metabolic rewiring

  • Heteroplasmy Considerations: For mtDNA-encoded MT-CO2 mutations, account for heteroplasmy levels (mixture of wild-type and mutant mtDNA) when interpreting phenotypic severity

These factors help contextualize research findings and avoid misinterpretation of experimental results.

What approaches can resolve discrepancies in MT-CO2 functional data between different experimental systems?

When faced with conflicting results across experimental systems, researchers should implement a systematic troubleshooting approach:

  • Standardize Protein Quality: Ensure consistent purity, folding state, and activity of recombinant MT-CO2 preparations across experiments

  • Cross-Validate with Multiple Techniques: Confirm findings using orthogonal methods that measure the same parameter through different physical principles

  • Conduct Control Experiments: Include positive and negative controls in each system to validate assay functionality and sensitivity

  • Consider System-Specific Factors: Account for differences in membrane composition, redox environment, or presence of accessory proteins across experimental systems

  • Evaluate Technical Variables: Systematically test whether discrepancies result from differences in protein concentration, buffer composition, temperature, or other experimental conditions

  • Examine Biological Context: Consider whether apparently conflicting results actually reflect biological complexity, such as tissue-specific regulation or interaction networks

  • Meta-Analysis Approach: Compile and systematically analyze data across multiple studies to identify patterns and sources of variation

This strategic approach can help distinguish genuine biological phenomena from technical artifacts, ultimately resolving apparent contradictions in experimental data.

How might emerging technologies advance our understanding of MT-CO2 function and dysfunction?

Several cutting-edge technologies show promise for revolutionizing MT-CO2 research:

  • Cryo-Electron Tomography: Enabling visualization of MT-CO2 and cytochrome c oxidase in its native cellular environment at near-atomic resolution

  • Single-Molecule Functional Studies: Providing insights into real-time electron transfer kinetics and conformational dynamics of individual MT-CO2 molecules

  • CRISPR-Based Mitochondrial Genome Editing: Allowing precise modification of MT-CO2 in mitochondrial DNA to study specific mutations

  • Organoid Models: Creating tissue-specific 3D cultures that better recapitulate the metabolic environment and tissue-specific manifestations of MT-CO2 dysfunction

  • AI-Driven Structural Prediction: Employing machine learning approaches like AlphaFold to predict structure-function relationships with greater accuracy

  • Microfluidic Respiratory Analysis: Enabling high-throughput screening of respiratory function in cells with MT-CO2 variants

  • In Situ Structural Analysis: Using techniques like cryo-electron microscopy combined with cellular tomography to visualize MT-CO2 assembly and interactions within intact mitochondria

These technologies will likely provide unprecedented insights into the molecular mechanisms underlying MT-CO2 function and its role in mitochondrial diseases.

What theoretical frameworks should guide research into evolutionary adaptations of MT-CO2 across primate species?

Research into MT-CO2 evolution should be guided by several theoretical frameworks:

  • Mitochondrial-Nuclear Co-Evolution Theory: Investigating how MT-CO2 (mitochondrially-encoded) co-evolves with nuclear-encoded subunits to maintain optimal complex function

  • Metabolic Rate Hypothesis: Examining how MT-CO2 variations might relate to differences in metabolic rate and energy requirements across primate species with different ecological niches

  • Thermal Adaptation Model: Exploring how MT-CO2 sequence variations might contribute to mitochondrial performance across temperature ranges relevant to different primate habitats

  • Environmental Stress Response Framework: Investigating how MT-CO2 variations might contribute to adaptation to environmental stressors such as hypoxia or dietary shifts

  • Comparative Genomics Approach: Utilizing phylogenetically informed comparative methods to distinguish between neutral evolution and adaptive selection in MT-CO2 sequence

These frameworks provide structured approaches to understand the evolutionary significance of MT-CO2 variations in Hapalemur griseus and related species, potentially revealing connections between molecular evolution and ecological adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.