Recombinant Hapalemur griseus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Hapalemur griseus (Gray gentle lemur) (Eastern lesser bamboo lemur)
Target Names
Target Protein Sequence
MPVQGSPRSLLGAVNSTPTATPHLRPAANQTGPQCLEVSIPDGLFLCLGLVSLVENTLVV AAIAKNRNLHSPMYCFVCCLALSDLLVSVSSVLETAVLLLLGAGALAAQATVVQLLGNVI DVLLCSSMVSSLFFLGAIAMDRYISIFYALRYHSIVTLARARRAIAAIWAASMLSSTLFI AYCDHTAALLCLVVFFLAMLVLMAVLYVHMLTQACQHAQGIARLHKRQRPVQQGWGLKGA ATLAILLGVFFLCWGPFFLHLTLIAVCPQHPTCSCIFKNFRLFLALIVCNAIVDPLIYAF RSQELCKTLKELLLFSW
Uniprot No.

Target Background

Function
This receptor binds to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by controlling cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Hapalemur griseus MC1R, and how does it compare to MC1R in other primates?

The Hapalemur griseus Melanocyte-stimulating hormone receptor (MC1R) is a 317 amino acid G-protein coupled receptor with a molecular structure typical of melanocortin receptors. The full protein includes transmembrane domains characteristic of the melanocortin receptor family, with the expression region spanning positions 1-317 . Structurally, primate MC1Rs show evolutionary conservation across species, though with important variations that may correspond to functional differences.

Comparative studies of MC1R evolution across primates have shown that while the receptor has been subject to purifying selection through most of its evolution, certain lineages show unique substitutions at functionally important sites, particularly in New World monkeys and lemurs . These structural differences likely reflect adaptations to specific environmental pressures affecting coat coloration.

What are the primary functions of MC1R in Hapalemur griseus, and do they differ from MC1R functions in other mammals?

In Hapalemur griseus, as in other mammals, MC1R forms a critical regulatory switch in melanin production, controlling the balance between eumelanin (black/brown pigments) and pheomelanin (orange/red pigments) during hair development . This receptor responds to melanocyte-stimulating hormone (MSH) to activate signaling pathways that influence pigmentation.

Unlike some mammals where MC1R variants strongly correlate with visible coat color differences, primate studies suggest that many intraspecific differences in primate coat color cannot be attributed solely to changes in MC1R coding sequences . This indicates that while MC1R plays a fundamental role in pigmentation biology across mammals, its specific contribution to phenotypic variation may differ among taxonomic groups, potentially involving different regulatory mechanisms or interactions with other genes in the pigmentation pathway.

How is the expression of MC1R regulated in Hapalemur griseus tissues?

While specific data on H. griseus MC1R expression regulation is limited, melanocortin receptor expression studies in mammals indicate tissue-specific regulation mechanisms. MC1R expression is primarily localized in melanocytes but can be modulated by various factors including UV radiation, hormones, and inflammatory mediators.

Research on melanocortin systems has demonstrated that peripheral administration of melanocortin agonists can affect central expression of melanocortin receptors. For example, peripherally administered NDP-MSH (a super potent non-selective melanocortin agonist) significantly decreased levels of mMC3R and mMC5R hypothalamic mRNA compared to saline controls . This suggests potential feedback mechanisms between peripheral and central melanocortin signaling that could be relevant for understanding MC1R expression regulation across tissues in primates including H. griseus.

What are the optimal methods for expressing recombinant Hapalemur griseus MC1R in laboratory settings?

Recombinant expression of H. griseus MC1R requires careful consideration of expression systems to maintain functional integrity. Based on established protocols for G-protein coupled receptors, the following methodological approach is recommended:

  • Vector Selection and Construction: Design expression vectors containing the full-length MC1R sequence (positions 1-317) with appropriate tags for detection and purification. Common tags include His-tag or FLAG-tag systems that allow for efficient purification while minimizing interference with receptor function.

  • Expression System Selection: Mammalian cell lines (HEK293, CHO) typically provide the most physiologically relevant post-translational modifications and membrane insertion for proper MC1R folding and function. For higher protein yields, insect cell systems (Sf9, High Five) may be considered with optimized conditions.

  • Expression Conditions: Optimal expression requires temperature control (typically 37°C for mammalian cells), appropriate induction protocols, and membrane-targeted expression strategies to ensure proper receptor trafficking to the cell surface.

  • Purification Strategy: Given that MC1R is a membrane protein, detergent-based extraction methods using mild detergents like DDM or LMNG are recommended to maintain structural integrity. Purification should be performed in buffer conditions containing 50% glycerol for stability .

  • Functional Validation: Binding assays with known MC1R ligands should be performed to confirm that the recombinant receptor maintains functional activity.

What are the challenges in studying ligand-receptor interactions for Hapalemur griseus MC1R, and how can they be addressed?

Studying ligand-receptor interactions for H. griseus MC1R presents several methodological challenges that require specific approaches:

  • Species-Specific Binding Characteristics: Research has revealed important species-specific differences in melanocortin receptor ligand potency between rodent and human systems . When studying H. griseus MC1R, these variations must be considered when interpreting binding data or extrapolating from other species.

  • Assay Selection: Multiple complementary assays should be employed, including:

    • Radioligand binding assays using labeled MSH peptides to determine binding affinities

    • Functional second messenger assays (cAMP accumulation) to assess receptor activation

    • BRET/FRET-based interaction studies to visualize binding in real-time

  • Addressing Membrane Protein Challenges: As a seven-transmembrane receptor, MC1R presents typical challenges of membrane protein studies. Nanodiscs or lipid reconstitution systems can provide a more native-like membrane environment for studying ligand interactions.

  • Control Experiments: Comparison with well-characterized MC1R variants from other species can provide internal controls. Truncation studies similar to those performed with γ2-MSH can identify specific amino acid residues critical for binding .

  • Computational Approaches: Molecular modeling and docking studies can complement experimental work to predict binding sites and interaction mechanisms, especially when crystal structures are unavailable.

How has MC1R evolved within the Hapalemur genus, and what implications does this have for adaptation and speciation?

The evolution of MC1R within Hapalemur provides insights into adaptation and speciation processes in this primate group. Phylogenetic studies have established that Hapalemur griseus is composed of four subspecies separated into two distinct clades, with H. g. griseus, H. g. alaotrensis, and H. g. occidentalis forming one clade, and H. g. meridionalis forming another .

Mitochondrial DNA analyses support elevating H. g. meridionalis to specific rank as H. meridionalis, while evidence does not support species status for H. g. alaotrensis despite morphological differences . A chromosomal polymorphic variant (H. g. ssp) from Ranomafana shows mtDNA clustering with either H. g. griseus or H. meridionalis, suggesting either ancestral polymorphism or introgression of mitochondrial DNA between subspecies .

These evolutionary patterns indicate that MC1R may have played different roles in adaptation across Hapalemur lineages. Unlike in some other mammals where MC1R variants strongly correlate with color phenotypes, primate studies suggest more complex relationships between genotype and phenotype. This complexity may reflect broader roles for MC1R beyond simple pigmentation control, potentially including adaptation to varying environmental conditions or social signaling functions.

How do MC1R ligand binding properties compare between Hapalemur griseus and other primate species?

Comparative analyses of MC1R ligand binding properties reveal significant species-specific differences that are crucial for research interpretation:

This comparative understanding is essential when designing experiments using recombinant H. griseus MC1R, as binding assays and functional studies may yield results that differ from those using human or other primate MC1R orthologs.

What insights from Hapalemur griseus MC1R research might be applicable to understanding human MC1R function and disease associations?

Research on H. griseus MC1R provides valuable comparative perspectives for understanding human MC1R function and disease associations, particularly in these areas:

How do MC1R polymorphisms in Hapalemur griseus compare to the functional variants identified in humans?

While specific polymorphism data for H. griseus MC1R is limited, comparative analysis between lemur and human MC1R variants provides valuable insights:

  • Functional Classification Systems: In humans, MC1R variants are often classified as "r" alleles (partial loss of function) or "R" alleles (complete loss of function) based on their impact on receptor activity . Carriers of R variants have a higher melanoma risk (OR 2.08; 95% CI 1.76–2.46) than carriers of only r variants (OR 1.24; 95% CI 1.04–1.47) . A similar classification system could be developed for H. griseus MC1R variants based on functional assays.

  • Direct vs. Indirect Effects: Human studies have used mediation analysis to decompose MC1R's effect on melanoma risk into direct (non-pigmentation) and indirect (pigmentation-mediated) pathways . Similar approaches could be applied to understanding the effects of H. griseus MC1R variants on phenotypic outcomes.

  • Evolutionary Context: Unlike in humans where MC1R variants strongly associate with pigmentation traits and disease risk, studies in primates suggest that many intraspecific differences in coat color cannot be attributed to changes in the MC1R coding sequence . This indicates potentially different evolutionary pressures acting on MC1R in different primate lineages.

What are the best approaches for analyzing the functional consequences of specific amino acid substitutions in Hapalemur griseus MC1R?

Analyzing functional consequences of amino acid substitutions in H. griseus MC1R requires integrated experimental approaches:

  • Site-Directed Mutagenesis: Systematic introduction of specific mutations into recombinant H. griseus MC1R constructs, focusing on:

    • Residues in transmembrane domains that interact with ligands

    • Residues in intracellular loops involved in G-protein coupling

    • Sites corresponding to functional variants identified in other species

  • Structure-Function Analysis: For each mutant receptor:

    • Ligand binding assays to determine changes in binding affinity

    • cAMP accumulation assays to measure signaling efficiency

    • Surface expression studies to assess membrane trafficking

    • Basal activity measurements to detect constitutive activation

  • Comparative Modeling: Use of in silico approaches to:

    • Generate 3D models based on available GPCR crystal structures

    • Predict structural impacts of mutations

    • Identify potential compensatory mutations

  • Evolutionary Constraint Analysis: Application of computational tools to:

    • Calculate selective pressure on specific codons

    • Identify sites under positive or negative selection

    • Compare patterns of constraint across primate lineages

  • Cell-Based Functional Assays: Development of:

    • Melanocyte models expressing wild-type or mutant receptors

    • Assays measuring melanin production and type (eumelanin vs. pheomelanin)

    • Signaling pathway activation profiles for different variants

This integrated approach allows for comprehensive characterization of how specific amino acid changes affect receptor function at molecular, cellular, and potentially phenotypic levels.

What considerations are important when designing experiments to study MC1R signaling pathways in Hapalemur griseus compared to other species?

When designing experiments to study MC1R signaling in H. griseus compared to other species, several critical considerations must be addressed:

  • Ligand Selection and Specificity:

    • Natural ligands (α-MSH, β-MSH, ACTH) may show species-specific potency differences

    • Synthetic agonists like NDP-MSH should be tested for cross-species efficacy

    • Species-specific differences in ligand potency have been observed between rodent and human systems

  • Signaling Pathway Components:

    • Verification of G-protein coupling preferences (typically Gαs for MC1R)

    • Assessment of adenylyl cyclase isoform expression in target cell types

    • Evaluation of downstream effector availability and function

  • Experimental Controls:

    • Parallel testing of human and H. griseus MC1R under identical conditions

    • Inclusion of closely related primate MC1Rs for comparative analysis

    • Use of pathway-specific activators and inhibitors as positive/negative controls

  • Cell System Selection:

    • Heterologous expression systems versus primary cells from the species of interest

    • Consideration of cell-specific factors that might influence receptor function

    • Assessment of the endogenous melanocortin system in selected cell lines

  • Quantification Methods:

    • Real-time kinetic measurements versus endpoint assays

    • Direct measurement of multiple pathway components (cAMP, Ca2+, ERK)

    • Integration of results across different signaling readouts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.