Recombinant Helianthus annuus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Helianthus annuus (Common sunflower)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDTQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPEIKEKMGNLSFQSYRPNQKNILVIGPVPG QKYSEITFPILSPDPATKKDIHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATASGIVS KILRKEKGGYEITIADASDGRQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFAAVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: han:4055667

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what is its role in photosynthesis?

Apocytochrome f is the precursor form of cytochrome f, lacking the covalently attached heme group. In its mature form, cytochrome f is a key component of the cytochrome b6f complex in the thylakoid membrane of chloroplasts. This complex plays a pivotal role in the electron transport chain during photosynthesis, facilitating electron transfer between photosystem II and photosystem I.

The biosynthesis of functional cytochrome f is a multistep process requiring processing of the precursor protein (apocytochrome f) and covalent ligation of a c-heme upon membrane insertion of the protein . The crystal structure analyses have revealed that one axial ligand of the c-heme is provided by the alpha-amino group of Tyr1, which is generated upon cleavage of the signal sequence from the precursor protein .

How is cytochrome f expression regulated during sunflower development?

Cytochrome f expression in sunflower (Helianthus annuus) shows tissue-specific and developmental stage-specific patterns. RNA in situ hybridization analyses have revealed distinct expression patterns in different tissues and organs:

  • Enhanced expression occurs in floral meristems as soon as they differentiate from the central portion of the capitulum containing the inflorescence meristem .

  • During early flower development, labeling is observed in all developing floral organ primordia .

  • As flowers mature, expression in petals decreases, while the central portion of the flower maintains strong labeling .

  • During stamen formation, hybridization signals are predominantly found in anthers .

  • In less developed flowers, expression is observed throughout the archesporial tissue .

  • During meiosis, labeling is mainly detected in tapetal cells .

This expression pattern suggests cytochrome f plays important roles during specific developmental stages, particularly in reproductive tissues.

What expression systems are suitable for recombinant Apocytochrome f production?

Several expression systems have been successfully used for the production of recombinant Apocytochrome f (petA), each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, short production time, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
YeastGood yield, some post-translational modificationsMore complex than bacterial systemsFunctional studies requiring some modifications
Insect cells (baculovirus)Many post-translational modificationsLonger production time, more expensiveStudies requiring proper protein folding
Mammalian cellsMost complete post-translational modificationsLowest yield, highest costActivity assays requiring native conformation

What methods are used to analyze cytochrome f expression at the RNA level?

RNA analysis techniques provide valuable insights into cytochrome f expression patterns. Common methodologies include:

  • Northern blot analysis: Total RNA is isolated by phenol extraction and LiCl precipitation, followed by electrophoresis through agarose/formaldehyde gels. RNA is then transferred to nylon membranes and hybridized with labeled cytochrome f probes .

  • RNA in situ hybridization: This technique allows visualization of gene expression within tissues:

    • Plant material is fixed in formaldehyde/acetic acid/ethanol solution

    • Tissues are embedded in paraffin and sectioned (5-7 μm thick)

    • Sections are mounted on poly-d-Lys coated slides

    • After deparaffinization and rehydration, sections are treated with proteinase K and acetic anhydride

    • Hybridization is performed with labeled probes (typically 1 μg/mL)

    • Post-hybridization washes remove unbound probe

    • Signal detection is performed using appropriate visualization methods

These techniques enable both quantitative assessment and spatial localization of cytochrome f transcripts in plant tissues.

How can site-directed mutagenesis be used to study Apocytochrome f processing and function?

Site-directed mutagenesis provides powerful insights into the structure-function relationships of Apocytochrome f. Research has demonstrated several effective approaches:

  • Cysteinyl residue substitution: Replacing the two cysteinyl residues responsible for covalent ligation of the c-heme with valine and leucine reveals that heme binding is not a prerequisite for cytochrome f processing . This approach helps distinguish between requirements for protein processing versus heme attachment.

  • Cleavage site modification: Replacing the consensus cleavage site for the thylakoid processing peptidase (AQA) with alternative sequences (e.g., LQL) can result in delayed processing of the precursor form of cytochrome f . Such modifications enable the study of processing kinetics and requirements.

  • C-terminal modifications: Experiments with truncated versions lacking the C-terminal membrane anchor demonstrate that this region influences the rate of synthesis of cytochrome f . The C-terminus appears to down-regulate protein synthesis rates, suggesting regulatory functions.

  • Chloroplast transformation: These modifications can be performed by chloroplast transformation using petA genes encoding either full-length precursor protein or truncated versions . This technique ensures proper targeting and expression in the native cellular environment.

These approaches have revealed that pre-apocytochrome f can adopt suitable conformations for cysteinyl residues to interact with heme lyase, and that pre-holocytochrome f can fold into assembly-competent conformations .

What is the relationship between petA expression and fertility restoration in sunflower breeding?

While direct links between petA expression and fertility restoration are not explicitly established in the search results, understanding cytoplasmic male sterility (CMS) systems provides relevant context for potential connections:

The PET2-cytoplasm represents a well-characterized source of cytoplasmic male sterility in sunflower, distinct from the widely used PET1-cytoplasm, although both were derived from interspecific crosses between Helianthus petiolaris and H. annuus . Fertility restoration is essential for using CMS PET2 in sunflower hybrid breeding.

Fertility restoration in PET2 cytoplasm is controlled by a major restorer gene, Rf-PET2, which has been mapped to the distal region of linkage group 13 between markers ORS1030 and ORS630 . Physical mapping has placed Rf-PET2 close to Rf1, the restorer gene for CMS PET1 .

Given that cytochrome f shows specific expression patterns in tapetal cells during meiosis , and tapetal cells are critical for pollen development, there may be functional relationships between petA expression and fertility restoration mechanisms. Further research integrating transcriptomic and proteomic analyses of petA expression in fertility restorer lines could elucidate these potential connections.

What experimental approaches can determine the interplay between protein processing and heme attachment?

Understanding the interplay between protein processing and heme attachment in cytochrome f requires sophisticated experimental approaches:

  • Genetic engineering with reporter systems:

    • Creating fusion proteins between Apocytochrome f and fluorescent or enzymatic reporters

    • Tracking both processing and heme attachment simultaneously through spectroscopic and biochemical methods

    • Using split-reporter systems to monitor protein-protein interactions during assembly

  • Time-course analyses:

    • Pulse-chase experiments with radioactive labeling to track the temporal progression of processing and heme attachment

    • Synchronized expression systems to capture intermediates

    • Quantitative western blotting with specific antibodies against different forms of the protein

  • Inhibitor studies:

    • Selective inhibition of processing peptidases

    • Targeted disruption of heme biosynthesis or attachment

    • Analysis of accumulating intermediates to determine the sequence of events

  • In vitro reconstitution assays:

    • Purification of components involved in both processing and heme attachment

    • Stepwise addition of components to recapitulate the complete maturation pathway

    • Biophysical characterization of intermediates using spectroscopy and structural methods

How do environmental factors affect petA expression and cytochrome f function?

Environmental factors significantly influence petA expression and cytochrome f function, reflecting the photosynthetic apparatus's ability to adapt to changing conditions:

  • Light conditions:

    • Fluctuating light environments trigger photosynthetic acclimation processes involving electron transport components including cytochrome f

    • High light conditions may increase demands on repair and turnover of photosynthetic components

  • Oxidative stress:

    • Ascorbate-deficient Arabidopsis mutants show alterations in photosynthetic electron transport under high light, suggesting cytochrome f function may be affected by redox status

    • Reactive oxygen species generated under stress conditions may damage thylakoid complexes and alter cytochrome f activity

  • Developmental programming:

    • The specific expression patterns of cytochrome f during flower development in sunflower suggest developmental regulation

    • Environmental cues that affect flowering time may indirectly influence cytochrome f expression patterns

  • Pathogen interactions:

    • The photosynthetic apparatus may be remodeled during pathogen responses

    • Research on sunflower resistance to downy mildew has mapped resistance genes, though direct links to cytochrome f remain to be established

Experimental approaches to study these environmental effects include:

  • Transcriptomic analyses under varied conditions

  • Protein turnover studies using pulse-chase experiments

  • Spectroscopic measurements of electron transport kinetics

  • Physiological measurements of photosynthetic parameters

What are the challenges in producing functional recombinant Helianthus annuus Apocytochrome f?

Producing functional recombinant Helianthus annuus Apocytochrome f presents several significant challenges that researchers must address:

  • Post-translational modifications:

    • The mature cytochrome f requires covalent heme attachment, which many expression systems cannot readily perform

    • Proper processing of the signal sequence is essential for generating the alpha-amino group of Tyr1 that serves as the axial ligand for the c-heme

    • These modifications are critical for proper folding and function

  • Membrane association:

    • Native cytochrome f contains a C-terminal membrane anchor that influences its synthesis rate and stability

    • Recombinant expressions often produce soluble variants that may not fully recapitulate the native protein's properties

    • The hydrophobic nature of the membrane domain can complicate expression in heterologous systems

  • Selection of expression system:

    • E. coli systems provide high yields but lack sophisticated post-translational modification machinery

    • Eukaryotic systems (yeast, insect, mammalian cells) offer better post-translational processing but with lower yields and higher costs

    • Chloroplast transformation in model plants provides the most native-like environment but is technically challenging

  • Protein stability and folding:

    • Misfolded forms of cytochrome f are subject to degradation by proteolytic systems associated with thylakoid membranes

    • Maintaining stability during purification requires careful buffer optimization

    • Verification of proper folding requires sophisticated biophysical techniques

  • Functional validation:

    • Assessing function requires reconstitution into membrane systems or creation of chimeric proteins

    • Electron transfer assays require partner proteins and appropriate redox mediators

    • Spectroscopic validation of heme environment is essential to confirm native-like structure

These challenges highlight the need for integrated approaches combining molecular biology, biochemistry, and biophysical techniques to successfully produce functional recombinant Apocytochrome f for research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.