Recombinant Helianthus annuus ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Source

Recombinant Helianthus annuus ATP synthase subunit a, chloroplastic (atpI) is a 247-amino acid protein (UniProt ID: Q1KXW8) expressed recombinantly for biochemical studies. It corresponds to the F0 sector subunit a of chloroplast ATP synthase, a critical component of photosynthetic energy conversion .

Functional Role in Chloroplast ATP Synthase

ATP synthase in chloroplasts couples proton translocation across thylakoid membranes to ATP synthesis during photosynthesis. Subunit a (atpI) forms part of the F0 sector, which facilitates proton movement to drive rotation of the c-subunit ring (cₙ), mechanically linked to ATP production in the F1 sector .

Mechanistic Insights

  • Proton Transport: Subunit a interacts with the cₙ ring, enabling proton flow through a conserved acidic residue pathway .

  • Regulation: Chloroplast ATP synthase activity is modulated by redox-sensitive cysteines on the γ subunit, preventing ATP hydrolysis in darkness .

Research Applications

This recombinant protein is used to:

  1. Investigate structure-function relationships in ATP synthase.

  2. Study proton translocation mechanisms in photosynthetic organisms.

  3. Develop inhibitors or modulators targeting chloroplast energy metabolism .

Open Questions and Future Directions

  1. How does atpI interact with other F0 subunits (e.g., cₙ ring) in sunflower?

  2. Can recombinant atpI be reconstituted into functional ATP synthase complexes in vitro?

  3. Does redox regulation indirectly affect subunit a’s function in proton channel stability ?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its implementation.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLNGLYDLSGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSAALAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLSYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: han:4055576

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does chloroplastic ATP synthase regulation differ between light and metabolic factors?

Chloroplast ATP synthase activity is regulated through two distinct mechanisms: light-dependent regulation and metabolism-related regulation. These regulatory pathways operate via different mechanisms:

  • Light-dependent regulation: This involves redox modulation of a disulfide/sulfhydryl pair on the γ subunit via thioredoxin. Research shows that mutating three highly conserved acidic amino acid residues in the γ subunit alters light-induced regulation without affecting metabolism-induced regulation .

  • Metabolic regulation: This operates independently of the light-regulation mechanism and is maintained even when light-responsive elements are altered through mutation .

The significance of this dual regulation lies in preventing wasteful ATP hydrolysis in the dark while allowing rapid activation during photosynthesis. The chloroplast ATP synthase serves as a key control point connecting light and dark reactions of photosynthesis .

What is the relationship between mitochondrial and chloroplastic ATP synthesis in Helianthus annuus?

Helianthus annuus possesses both mitochondrial and chloroplastic ATP synthesis pathways that serve complementary but distinct roles:

  • Mitochondrial ATP synthesis: Even in dry sunflower seeds, mitochondria can synthesize ATP upon rehydration. Studies demonstrate ATP synthesis with various substrates including citrate, α-ketoglutarate, succinate, malate, pyruvate, and NADH. The process is activated by cytochrome c and inhibited by typical respiratory inhibitors like cyanide and oligomycin .

  • Chloroplastic ATP synthesis: This pathway utilizes light energy to establish a proton gradient across the thylakoid membrane. The ATP synthase complex, including the atpI subunit, harnesses this gradient for ATP production during photosynthesis .

The ATP/O values with succinate in mitochondrial synthesis were measured at 0.85 without cytochrome c and 1.2 with cytochrome c present . This dual energy generation system allows sunflowers to produce ATP under varying environmental conditions.

What are the optimal conditions for storing and handling recombinant Helianthus annuus atpI protein?

For optimal stability and experimental reproducibility when working with recombinant Helianthus annuus atpI protein, researchers should follow these storage and handling guidelines:

ParameterRecommendation
Storage temperature-20°C for regular use; -80°C for extended storage
Buffer compositionTris-based buffer with 50% glycerol
Freeze-thaw cyclesMinimize; repeated freezing and thawing not recommended
Working aliquotsStore at 4°C for up to one week
Protein concentrationStandard working concentration: 0.1-1.0 mg/mL

The protein is typically supplied as 50 μg per vial in a stabilized buffer formulation . When designing experiments, consider that the tag type may vary depending on the production process, which could affect protein behavior in certain assay systems.

How can researchers effectively isolate functional chloroplastic ATP synthase from Helianthus annuus tissues?

Isolation of functional chloroplastic ATP synthase from Helianthus annuus involves several critical steps:

  • Tissue selection: Leaf tissue shows the highest expression of ATP synthase components, making it the optimal source material. Research indicates that transcripts for ATP synthase components accumulate most abundantly in leaf tissue compared to other plant parts .

  • Isolation buffer: Use a buffer containing 0.3-0.4M sorbitol, 50mM HEPES-KOH (pH 7.6), 1mM MgCl₂, 1mM EDTA, 1mM DTT, and protease inhibitors.

  • Differential centrifugation: Following homogenization, use sequential centrifugation steps (1,000×g, 10,000×g, and 100,000×g) to separate chloroplasts, thylakoid membranes, and finally ATP synthase complexes.

  • Detergent solubilization: Carefully solubilize membranes using mild detergents like n-dodecyl-β-D-maltoside (0.5-1.0%) or digitonin (0.5-2.0%).

  • Purification: Apply the solubilized sample to ion exchange chromatography followed by size exclusion chromatography.

The functionality of isolated ATP synthase can be verified through ATP synthesis assays using artificial proton gradients or reconstitution into liposomes .

What approaches can be used to measure ATP synthase activity in Helianthus annuus?

Several methodological approaches can be employed to measure ATP synthase activity in Helianthus annuus:

  • Oxidative phosphorylation assays: Similar to techniques used with mitochondria, researchers can measure ATP production with various substrates. Studies with sunflower mitochondria have successfully used citrate, α-ketoglutarate, succinate, malate, pyruvate, and NADH as substrates .

  • Proton flux measurements: Using pH-sensitive fluorescent dyes or electrodes to monitor proton movement across membranes during ATP synthesis.

  • ATP production quantification: Measure ATP synthesis rates using luciferase-based assays or HPLC analysis.

  • Inhibitor studies: Apply specific inhibitors like oligomycin to verify ATP synthase-dependent activity. Research shows that ATP synthesis in sunflower mitochondria is inhibited by cyanide, oligomycin, carbonyl cyanide p-(trifluoromethoxy)phenylhydrazone, and carboxyatractyloside .

  • Redox regulation assessment: For chloroplastic ATP synthase, researchers can examine the influence of thioredoxin-mediated regulation by manipulating redox conditions and measuring resulting activity changes .

When designing these assays, it's essential to consider the ATP/O ratios, which have been measured at 0.85-1.2 for mitochondrial ATP synthesis in sunflower, depending on the presence of cytochrome c .

How does the structure-function relationship of atpI contribute to ATP synthase regulation in Helianthus annuus?

The atpI subunit's structure-function relationship in Helianthus annuus reveals several key aspects:

  • Transmembrane proton channel: The atpI subunit forms part of the critical proton channel through which the proton motive force (pmf) drives ATP synthesis. Its hydrophobic amino acid composition facilitates membrane integration and proton conductance .

  • Interface with rotary mechanism: The subunit interacts with the rotating elements of the ATP synthase complex, helping convert proton flow into mechanical energy for ATP synthesis.

  • Regulatory interactions: While the redox-active cysteine residues that mediate thioredoxin regulation are located on the γ subunit (specifically Cys-199 and Cys-205 in Arabidopsis thaliana), the atpI subunit's conformation may influence the accessibility of these regulatory sites .

  • Structural adaptation: The protein structure includes multiple transmembrane domains that must be correctly folded and inserted into the chloroplast membrane. This process likely involves N-terminal targeting sequences similar to those identified in other chloroplast proteins .

Understanding these structure-function relationships provides insights into how the enzyme balances efficient energy conversion with tight regulation in response to environmental and metabolic changes.

How can genetic engineering of atpI be used to improve photosynthetic efficiency in Helianthus annuus or other crops?

Genetic engineering approaches targeting atpI could potentially enhance photosynthetic efficiency through several strategies:

  • Optimizing regulatory response: Engineering the interface between atpI and regulatory subunits could fine-tune the enzyme's activation in response to light intensity. Research on γ subunit mutations demonstrates that modification of specific amino acid residues can alter light-dependent regulation while preserving metabolism-dependent regulation .

  • Modifying proton conductance: Strategic mutations in the transmembrane domains of atpI could optimize proton flow rates, potentially increasing ATP synthesis efficiency under varying light conditions.

  • Enhancing stability: Engineering increased protein stability could extend the functional lifetime of ATP synthase complexes, reducing energy investment in protein turnover.

  • Cross-species optimization: Transferring beneficial structural features from atpI variants in highly efficient photosynthetic organisms could improve sunflower performance.

  • Coordinated regulation: Engineering coordinated expression of atpI with other photosynthetic components could reduce bottlenecks in energy conversion. Research shows that in sunflower, ATP synthase component expression is highest in leaf tissues, suggesting tissue-specific regulation is important .

These approaches require careful consideration of the complex interactions within the ATP synthase complex and its integration with broader photosynthetic processes.

How do researchers interpret contradictory data regarding atpI function across different experimental systems?

When facing contradictory data regarding atpI function, researchers should apply these systematic analysis approaches:

  • System-specific context: Consider that ATP synthase function differs between in vitro and in vivo systems. Mitochondria from dry sunflower seeds, for example, show different structures when observed in situ versus after aqueous extraction, suggesting profound changes occur upon rehydration .

  • Regulatory network differences: Assess the regulatory networks present in each experimental system. The light and metabolic regulation pathways of ATP synthase operate via distinct mechanisms , and their relative importance may vary between systems.

  • Protein isoform verification: Confirm which specific protein isoform is being studied. Sequence verification is essential, as minor variations can cause functional differences.

  • Interaction partners: Identify the presence or absence of critical interaction partners. For example, cytochrome c significantly affects ATP/O ratios in mitochondrial ATP synthesis, increasing values from 0.85 to 1.2 in sunflower mitochondria .

  • Methodological differences: Evaluate differences in purification methods, buffer compositions, and activity assays that might explain contradictory results.

  • Species-specific features: Consider evolutionary adaptations that might cause species-specific functional differences in ATP synthase components.

By systematically addressing these factors, researchers can often reconcile seemingly contradictory findings and develop a more comprehensive understanding of atpI function.

What are the methodological challenges in comparing ATP synthase activity data between different plant tissues and developmental stages?

Comparing ATP synthase activity across different tissues and developmental stages presents several methodological challenges:

  • Expression level variations: Transcripts of ATP synthase components like HaLIP1m and HaLIP2m show tissue-specific expression patterns, with highest levels in leaf tissue and decreasing expression during later seed developmental stages (25-28 days after flowering) . These variations necessitate normalization strategies.

  • Tissue-specific ATP requirements: Different tissues have varying ATP demands. Leaf mesophyll has high requirements due to photorespiration processes, particularly the glycine cleavage system , affecting baseline ATP synthase activity.

  • Isolation efficiency differences: Membrane protein extraction efficiency varies between tissues. Developing seeds, vegetative tissues, and mature leaves require different isolation protocols for optimal ATP synthase recovery.

  • Regulatory state preservation: Maintaining the native regulatory state of ATP synthase during isolation is challenging. The enzyme is regulated by both light and metabolic factors through distinct mechanisms , which may be differentially preserved during sample preparation.

  • Developmental changes in membrane composition: Membrane lipid composition changes during development, potentially affecting ATP synthase activity independent of enzyme abundance or intrinsic catalytic properties.

  • Assay compatibility issues: Some activity assays work better with certain tissue types. Researchers must validate that their chosen assay provides comparable results across different tissue samples.

To address these challenges, researchers should employ multiple complementary techniques and include appropriate internal controls for each tissue type and developmental stage.

How can researchers integrate information about atpI with broader metabolic network analysis in Helianthus annuus?

Integrating atpI function into broader metabolic network analysis requires sophisticated approaches:

  • Flux balance analysis: Incorporate ATP synthase activity data into metabolic flux models. Research shows that in developing sunflower embryos, a maximum of 20% of produced ATP is utilized in substrate cycles , providing a constraint for metabolic models.

  • Multi-omics integration: Combine proteomics data on ATP synthase abundance with transcriptomics data showing expression patterns of ATP synthase components, which are highest in leaf tissue and decrease during seed development .

  • Regulatory network mapping: Map connections between ATP synthase regulation and other metabolic networks. Consider both light-dependent regulation involving thioredoxin-mediated redox modulation and metabolism-related regulation, which operate via distinct mechanisms .

  • Energy allocation analysis: Quantify ATP distribution among competing metabolic pathways under different conditions. This can reveal how energy constraints influence metabolic network operation.

  • Comparative systems analysis: Compare metabolic network configurations across different tissues or developmental stages, considering how ATP synthase activity changes impact downstream metabolism.

  • Perturbation studies: Analyze network responses to specific ATP synthase inhibitors like oligomycin to reveal dependency relationships and regulatory mechanisms.

This integrated approach provides a comprehensive understanding of how atpI function influences and is influenced by broader metabolic networks in Helianthus annuus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.