Recombinant Helianthus annuus Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Shipping is standard with blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLLYLVSIVFLPWWISLLFQKSLESWVTNWWNTRQSETFLNDIEEKSILEKF IELEELLFLEEMIKEYSETHLQNLRIGIHKETIQLIKIQNEGRIHTILHFSTNIICFIIL SGYSILGNKELVILNSWAQEFLYNLSDTIKAFSLLLLTDLCIGFHSPHGWELMIGFVYKD FGFVHNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: han:4055660

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of the cemA gene in Helianthus annuus?

The cemA gene in Helianthus annuus is encoded by the chloroplast genome. Like other chloroplast-encoded genes in sunflower, it is part of the conserved genetic elements maintained throughout evolutionary history. Sunflower genomic research has advanced significantly with multiple well-curated reference genomes now available, including those accessible through databases like Ensembl Plants and the Heliagene project . Based on comparative analysis with other Compositae species, the cemA gene would follow similar structural patterns to other chloroplast genes, which typically have conserved protein domains that can be identified using tools like Hidden Markov Models and validated through databases such as NCBI-CDD . Researchers looking to identify and characterize the cemA gene should consider using these bioinformatics approaches as demonstrated in studies of other sunflower genes.

How does cemA protein localization in Helianthus annuus compare to other plant species?

The cemA protein in Helianthus annuus, like in other plants, is primarily localized to the chloroplast envelope membrane. Subcellular localization prediction tools such as EuLoc, which has been successfully used for other sunflower proteins, can help confirm this localization . In sunflower research, protein subcellular localization analysis has revealed that most chloroplast proteins are directed to their target locations via N-terminal transit peptides. Similar to the OSCA family proteins in sunflower, which show localization to various organelles including chloroplasts, the cemA protein localization can be experimentally verified using GFP fusion proteins and confocal microscopy. Comparative studies with the 15 identified OSCA family members in sunflower, which have varied localizations including chloroplast, endoplasmic reticulum, vacuole, Golgi apparatus, and mitochondrion, would provide valuable insights into cemA trafficking and function .

What expression patterns does cemA show across different tissues and developmental stages in sunflower?

Expression patterns of chloroplast genes like cemA in Helianthus annuus can be studied using transcriptome sequencing approaches similar to those used for nuclear genes. RNA-seq analysis of different sunflower tissues under various conditions has been successfully performed and this data is available through databases like NCBI (accession numbers SRP092742 and PRJNA866668) . To analyze cemA expression patterns:

  • Download RNA-seq data from public repositories

  • Process raw data using tools like Fastp for filtering and quality control

  • Align filtered data to the sunflower reference genome using Hisat2

  • Quantify expression using StringTie software

  • Normalize expression data using FPKM method and log10 transformation

  • Visualize expression patterns using heatmaps generated with tools like TBtools

Additionally, qRT-PCR can be used to validate expression patterns in specific tissues, using HaActin as a reference gene for normalization, and employing the 2^-ΔΔCt method for relative quantification .

What are the optimal conditions for expressing recombinant Helianthus annuus cemA in heterologous systems?

For optimal expression of recombinant Helianthus annuus cemA in heterologous systems, researchers should consider:

  • Expression System Selection: For membrane proteins like cemA, E. coli systems with specific membrane protein expression enhancements (such as C41/C43 strains) often provide better results than standard BL21 strains.

  • Codon Optimization: Sunflower genes typically have codon usage patterns that differ from common expression hosts. Codon optimization should consider the high GC content variation found in sunflower genes, similar to what has been observed in other sunflower gene families .

  • Expression Temperature and Induction: Lower temperatures (16-20°C) after induction and lower IPTG concentrations often improve membrane protein folding and reduce inclusion body formation.

  • Fusion Tags: For chloroplast membrane proteins, adding fusion tags that aid in membrane targeting and later purification is recommended. N-terminal tags are generally preferable since the C-terminus may be important for function.

  • Detergent Selection: For extraction and purification, mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) are typically more effective for maintaining the native structure of chloroplast membrane proteins.

The experimental approach should be informed by the physicochemical properties of the protein. Similar to the OSCA family proteins in sunflower which range from 648-838 amino acids in length with molecular weights of 73.42-96.62 kDa and isoelectric points of 7.61-9.94 , cemA's specific characteristics will influence optimal expression conditions.

How can researchers effectively purify recombinant cemA while maintaining its structural integrity?

Purification of recombinant cemA while maintaining structural integrity presents several challenges due to its membrane-bound nature. A methodological approach includes:

  • Membrane Fraction Isolation:

    • Harvest cells and disrupt using gentle methods (sonication with cooling intervals or French press)

    • Separate membrane fraction through differential centrifugation

    • Wash membranes to remove peripheral proteins

  • Solubilization Screening:

    • Test a panel of detergents at different concentrations (typically 0.5-2%)

    • Include detergent screening with DDM, LMNG, digitonin, and fluorinated detergents

    • Validate solubilization efficiency by Western blotting

  • Affinity Chromatography:

    • Use immobilized metal affinity chromatography (IMAC) with His-tagged cemA

    • Include detergent at concentrations above critical micelle concentration (CMC) in all buffers

    • Elute using imidazole gradient to minimize co-purification of contaminants

  • Quality Assessment:

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to confirm secondary structure content

    • Thermal stability assays to assess protein stability in different buffer conditions

  • Stabilization Strategies:

    • Screen lipid additives that may enhance stability (e.g., E. coli polar lipids or sunflower chloroplast lipid extracts)

    • Test amphipols or nanodiscs for detergent-free stabilization

This approach draws on techniques used for other challenging membrane proteins and can be adapted based on cemA's specific characteristics.

What functional assays can be used to verify recombinant cemA activity compared to the native protein?

To verify the functional activity of recombinant cemA compared to the native protein, researchers can employ several complementary approaches:

  • CO₂ Uptake Assays:

    • Reconstitute purified cemA into liposomes

    • Measure CO₂ uptake using pH-sensitive fluorescent dyes

    • Compare kinetics with native chloroplast preparations

  • Complementation Studies:

    • Transform cemA-deficient mutants with the recombinant gene

    • Assess restoration of photosynthetic efficiency under varying CO₂ concentrations

    • Measure growth rates under different light and CO₂ conditions

  • Protein Interaction Analysis:

    • Perform pull-down assays to identify interacting partners

    • Use techniques like microscale thermophoresis to measure binding affinities

    • Compare interaction profiles between recombinant and native cemA

  • Stress Response Assessment:

    • Similar to studies on the OSCA gene family in sunflower , examine cemA's response to environmental stresses

    • Test functionality under drought conditions similar to those used in sunflower accession screening (-1.33 MPa and -1.62 MPa using PEG-6000)

    • Evaluate expression changes under salt stress conditions

  • Structural Integrity Verification:

    • Use limited proteolysis to compare folding patterns

    • Apply circular dichroism spectroscopy to assess secondary structure

    • When possible, compare with native protein extracted from sunflower chloroplasts

These methodological approaches provide a comprehensive assessment of whether the recombinant cemA maintains the functional characteristics of the native protein.

How do genetic variations in cemA across different Helianthus annuus accessions correlate with photosynthetic efficiency under stress conditions?

Investigating genetic variations in cemA across different Helianthus annuus accessions and their correlation with photosynthetic efficiency under stress requires a multi-faceted approach:

  • Accession Screening and Sequencing:

    • Select diverse sunflower accessions, similar to the 60 accessions used in drought tolerance studies

    • Sequence the cemA gene region from each accession

    • Identify single nucleotide polymorphisms (SNPs) and structural variants

  • Phenotypic Characterization Under Stress:

    • Evaluate photosynthetic parameters under controlled stress conditions:

      • Drought stress using PEG-6000 at different concentrations (e.g., 15g and 20g per 100mL) to create osmotic potentials of -1.33 MPa and -1.62 MPa

      • Salt stress treatments similar to those used in OSCA gene studies

      • Heat stress at temperatures relevant to sunflower cultivation regions

  • Genotype-Phenotype Association Analysis:

    • Perform association studies between cemA variants and photosynthetic traits

    • Use principal component analysis to identify accessions with extreme phenotypes

    • Develop a scoring system similar to drought tolerance indexes used in previous sunflower research

  • Functional Validation:

    • Express different cemA variants in recombinant systems

    • Compare protein stability and function across variants

    • Use chloroplast transformation to swap cemA variants between accessions

  • Transcriptional Response Analysis:

    • Quantify cemA expression using qRT-PCR with the 2^-ΔΔCt method

    • Compare expression patterns across accessions under different stress conditions

    • Identify potential transcriptional regulators of cemA

This comprehensive approach would help identify cemA variants associated with enhanced photosynthetic efficiency under stress conditions, potentially contributing to breeding programs for climate-resilient sunflower varieties.

What is the role of cemA in hybrid vigor observed in crosses between different Helianthus species?

The potential role of cemA in hybrid vigor observed in crosses between different Helianthus species represents an intriguing research question that can be approached methodologically:

  • Comparative Sequence Analysis:

    • Sequence and compare cemA across Helianthus species, particularly those involved in hybridization events

    • Analyze sequence divergence patterns in comparison to other chloroplast genes

    • Examine the relationship between sequence divergence and hybrid performance

  • Chloroplast Inheritance Patterns:

    • Track chloroplast inheritance in hybrid zones between species like H. annuus and H. petiolaris

    • Determine if specific cemA variants are preferentially retained in hybrid populations

    • Compare with patterns observed at nuclear genomic regions

  • Expression Studies in Hybrids:

    • Quantify cemA expression in parental species and their hybrids

    • Assess whether expression patterns correlate with photosynthetic efficiency

    • Examine if cemA shows altered expression in stabilized hybrid species that have emerged in the southwestern United States

  • Protein Function Comparison:

    • Express cemA variants from different Helianthus species in recombinant systems

    • Compare functional parameters (CO₂ uptake, protein stability)

    • Assess if heterotic effects might result from complementation at the protein level

  • Field Performance Studies:

    • Design reciprocal transplant experiments with parents and hybrids

    • Measure photosynthetic parameters in natural settings where hybrid zones occur

    • Test if cemA variants correlate with adaptation to specific environments

The highly polymorphic nature of the Helianthus genus, with its remarkable genetic variation compared to other flowering plants , provides an excellent system for studying the role of chloroplast genes in hybrid vigor. This research could build upon existing knowledge about hybridization between H. annuus and H. petiolaris, which has been extensively studied for chromosomal rearrangements and the maintenance of species differences despite gene flow .

How can CRISPR-Cas9 technology be optimized for editing the cemA gene in the Helianthus annuus chloroplast genome?

Optimizing CRISPR-Cas9 technology for editing the cemA gene in the chloroplast genome of Helianthus annuus requires addressing several unique challenges associated with chloroplast genome editing:

Table 1: Comparison of Key Parameters for Chloroplast CRISPR-Cas9 Editing in Helianthus annuus

ParameterStandard Nuclear CRISPRChloroplast-Optimized CRISPRRationale for Modification
Cas9 VariantSpCas9Chloroplast codon-optimized SpCas9Improve expression efficiency in chloroplast environment
PromoterCaMV 35SPpsbA (photosystem II protein D1)Native chloroplast promoter for higher expression
TerminatorNOSrps16Chloroplast-specific terminator for proper transcription termination
Transit PeptideNoneRBCL transit peptideDirect nuclear-expressed Cas9 to chloroplasts
gRNA DesignStandard NGG PAMNGG PAM with chloroplast-specific criteriaAccount for polyploid nature of chloroplast genome
Delivery MethodAgrobacteriumBiolistic transformationMost effective for chloroplast transformation
Selection Markerkanamycin, hygromycinSpectinomycin, aadAEffective for chloroplast transformant selection
Homology Arms0.5-1 kb1-2 kbLonger homology required for efficient chloroplast HR

The methodological approach for chloroplast cemA editing includes:

  • Vector Construction:

    • Design a vector containing chloroplast-specific promoters and terminators

    • Include homology arms flanking the cemA target region

    • Incorporate spectinomycin resistance (aadA) as a selectable marker

  • gRNA Design Optimization:

    • Select target sites unique to cemA to prevent off-target effects

    • Assess gRNA efficiency using in silico prediction tools

    • Test multiple gRNAs to identify the most efficient

  • Delivery Protocol Development:

    • Optimize biolistic parameters for sunflower leaf tissue

    • Determine ideal developmental stage of tissue for transformation

    • Test various osmotic treatments pre- and post-bombardment

  • Selection and Regeneration:

    • Develop a two-stage selection protocol on spectinomycin

    • Ensure homoplasmy through multiple regeneration cycles

    • Confirm complete replacement of wild-type chloroplast genomes

  • Validation Strategy:

    • PCR-based screening of transplastomic lines

    • Whole chloroplast genome sequencing to confirm editing

    • Functional analysis of photosynthetic parameters

This methodological framework addresses the specific challenges of chloroplast genome editing in sunflower, building on knowledge of sunflower transformation and the polyploid nature of the chloroplast genome. The approach could be particularly valuable for understanding cemA function and potentially improving photosynthetic efficiency in this important crop species.

What are the optimal conditions for studying cemA-protein interactions in Helianthus annuus chloroplasts?

Studying cemA-protein interactions in Helianthus annuus chloroplasts requires specialized approaches to overcome challenges associated with membrane protein complexes in the chloroplast envelope:

  • Chloroplast Isolation Protocol:

    • Harvest young sunflower leaves (10-14 days post-germination)

    • Homogenize in isotonic buffer with protease inhibitors

    • Purify intact chloroplasts through Percoll gradient centrifugation

    • Verify integrity using microscopy and envelope marker proteins

  • Interaction Capture Methods:

    • Crosslinking Strategy: Use membrane-permeable crosslinkers like DSP (dithiobis(succinimidyl propionate)) at 0.5-2 mM

    • Co-immunoprecipitation: Develop cemA-specific antibodies or use epitope-tagged versions

    • Proximity Labeling: Employ BioID or APEX2 fused to cemA for in vivo interaction mapping

  • Complex Isolation Techniques:

    • Solubilize membranes using digitonin (1-2%) or mild non-ionic detergents

    • Preserve interactions using blue native PAGE

    • Separate complexes by size using gradient gels

    • Identify components by mass spectrometry

  • Validation Approaches:

    • BiFC (Bimolecular Fluorescence Complementation) for in vivo confirmation

    • Split ubiquitin assays for membrane protein interactions

    • Förster resonance energy transfer (FRET) analysis

  • Data Analysis Strategy:

    • Filter interaction candidates against control datasets

    • Validate high-confidence interactions through reciprocal pulldowns

    • Classify interactors by function and predicted localization

This methodological framework provides a comprehensive approach to studying cemA interactions within the native chloroplast environment, helping to elucidate its functional role in CO₂ transport and potentially in stress responses similar to those studied in the OSCA gene family .

How does the evolution of cemA in Helianthus annuus compare to its orthologs in other Compositae species?

The evolutionary analysis of cemA in Helianthus annuus compared to its orthologs in other Compositae species can reveal important insights about selection pressures and functional conservation:

  • Sequence Collection and Alignment:

    • Extract cemA sequences from chloroplast genomes of multiple Compositae species, including the seven species extensively studied for other gene families: Helianthus annuus, Arctium lappa, Chrysanthemum morifolium, Cichorium endivia, Cichorium intybus, Lactuca sativa, and Carthamus tinctorius

    • Align sequences using MUSCLE or MAFFT algorithms with parameters optimized for coding sequences

    • Manually curate alignments to ensure proper codon alignment

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using Maximum Likelihood and Bayesian methods

    • Assess node support through bootstrap and posterior probability values

    • Compare cemA tree topology with species relationships to identify potential incongruences

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify signatures of selection

    • Apply site-specific models to detect positively selected residues

    • Compare with other chloroplast genes to determine if cemA evolves under unique constraints

  • Structural Implications:

    • Map conserved and variable regions onto predicted protein structure

    • Identify domains under different selection pressures

    • Assess if functional domains show higher conservation across species

  • Correlated Evolution:

    • Test for co-evolution with interacting proteins

    • Examine if adaptation to different environments correlates with sequence changes

    • Compare evolutionary rates with nuclear-encoded partners

Table 2: Comparison of cemA Evolutionary Parameters Across Compositae Species

SpeciesSequence Length (bp)Nucleotide Diversity (π)dN/dS RatioConserved DomainsPredicted Function
Helianthus annuus~690*To be determinedTo be determinedChloroplast envelope membrane protein domainCO₂ transport
Arctium lappa~690*To be determinedTo be determinedChloroplast envelope membrane protein domainCO₂ transport
Chrysanthemum morifolium~690*To be determinedTo be determinedChloroplast envelope membrane protein domainCO₂ transport
Cichorium endivia~690*To be determinedTo be determinedChloroplast envelope membrane protein domainCO₂ transport
Cichorium intybus~690*To be determinedTo be determinedChloroplast envelope membrane protein domainCO₂ transport
Lactuca sativa~690*To be determinedTo be determinedChloroplast envelope membrane protein domainCO₂ transport
Carthamus tinctorius~690*To be determinedTo be determinedChloroplast envelope membrane protein domainCO₂ transport

*Estimated length based on typical cemA genes in other plant species; actual lengths may vary slightly.

This evolutionary analysis approach would shed light on how cemA has evolved within the Compositae family and potentially identify adaptive changes related to different ecological niches, similar to what has been observed in other gene families like OSCA .

What biophysical techniques are most effective for determining the structure-function relationship of recombinant Helianthus annuus cemA?

Determining the structure-function relationship of recombinant Helianthus annuus cemA requires specialized biophysical approaches suitable for membrane proteins:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Prepare cemA samples in various detergents or nanodiscs

    • Optimize grid preparation with specific parameters:

      • Protein concentration: 0.5-5 mg/mL

      • Grid type: Quantifoil R1.2/1.3 or UltrAuFoil

      • Blotting conditions: 3-5 seconds at 100% humidity, 4°C

    • Collect data at high-end microscopes (300 kV)

    • Process data using software packages like RELION or cryoSPARC

    • Achieve resolution sufficient to resolve transmembrane helices (3-4 Å)

  • Solid-State NMR Spectroscopy:

    • Express isotopically labeled protein (¹⁵N, ¹³C)

    • Reconstitute in lipid bilayers mimicking chloroplast membrane composition

    • Optimize magic angle spinning parameters

    • Collect distance constraints and torsion angles

    • Generate structural models through computational approaches

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare exchange rates between different functional states

    • Map regions with differential solvent accessibility

    • Identify potential conformational changes associated with transport

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Introduce spin labels at specific positions through site-directed mutagenesis

    • Measure distances between labeled sites

    • Determine membrane topology and conformational changes during function

  • Molecular Dynamics Simulations:

    • Build homology models based on related structures

    • Embed models in simulated chloroplast membranes

    • Run extended simulations (>1 μs) to observe conformational dynamics

    • Test hypotheses about CO₂ transport mechanisms

Table 3: Comparison of Biophysical Methods for cemA Structure-Function Analysis

The integration of multiple biophysical techniques would provide complementary information about cemA structure and function, allowing researchers to develop a comprehensive model of how this protein facilitates CO₂ transport across the chloroplast envelope membrane in Helianthus annuus.

How might genetic engineering of cemA contribute to improving photosynthetic efficiency in Helianthus annuus under climate change scenarios?

Genetic engineering of cemA represents a promising approach for improving photosynthetic efficiency in Helianthus annuus under climate change scenarios:

These approaches could significantly contribute to developing climate-resilient sunflower varieties. Given that sunflower is already known for its adaptability to various environments, including deserts, sand dunes, and salt marshes , targeted engineering of cemA could further enhance this adaptability.

What are the most promising techniques for studying cemA regulation in response to changing CO₂ levels and environmental stresses?

Studying the regulation of cemA in response to changing CO₂ levels and environmental stresses requires sophisticated techniques that can capture dynamic responses:

  • Real-time Expression Monitoring:

    • Develop cemA promoter-reporter fusions (e.g., luciferase or fluorescent proteins)

    • Create transgenic sunflower lines with these reporters

    • Monitor expression changes in real-time under varying conditions:

      • CO₂ concentrations (ambient, elevated, reduced)

      • Drought stress conditions similar to experimental setups using PEG-6000

      • Temperature fluctuations

  • Transcriptional Regulation Analysis:

    • Perform chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors binding to the cemA promoter

    • Use electrophoretic mobility shift assays (EMSA) to confirm specific interactions

    • Identify cis-acting elements similar to the approach used for the OSCA gene family, where PlantCARE database was used to predict promoter elements

  • Post-transcriptional Regulation:

    • Analyze RNA stability through actinomycin D chase experiments

    • Investigate potential RNA-binding proteins that regulate cemA mRNA

    • Examine if small RNAs are involved in regulation

  • Post-translational Modification Mapping:

    • Use mass spectrometry to identify phosphorylation, acetylation, or other modifications

    • Develop antibodies specific to modified forms of cemA

    • Track changes in modification patterns under various stress conditions

  • Protein Turnover Assessment:

    • Perform pulse-chase experiments with isotope-labeled amino acids

    • Determine protein half-life under different environmental conditions

    • Identify proteases involved in cemA degradation

Table 4: Experimental Design for cemA Regulation Studies Under Combined Stresses

Stress CombinationCO₂ Levels (ppm)Drought Stress (MPa)Salt Stress (mM NaCl)Temperature (°C)Measurement Time Points (hours)Key Parameters Measured
Control40000250, 1, 3, 6, 12, 24, 48cemA transcript level, protein level, PTMs
Elevated CO₂80000250, 1, 3, 6, 12, 24, 48cemA transcript level, protein level, PTMs
Drought400-1.330250, 1, 3, 6, 12, 24, 48cemA transcript level, protein level, PTMs
Salt4000150250, 1, 3, 6, 12, 24, 48cemA transcript level, protein level, PTMs
Heat40000380, 1, 3, 6, 12, 24, 48cemA transcript level, protein level, PTMs
Combined (Future climate)800-1.330380, 1, 3, 6, 12, 24, 48cemA transcript level, protein level, PTMs

This comprehensive approach would provide detailed insights into the regulatory mechanisms governing cemA expression and function under changing environmental conditions, potentially identifying regulatory elements that could be targeted in breeding programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.