Recombinant Helianthus annuus Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: han:4055690

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex subunit 4 (petD) in sunflower?

The petD gene in Helianthus annuus encodes subunit 4 of the cytochrome b6-f complex, an essential component of the photosynthetic electron transport chain located in the thylakoid membrane of chloroplasts. This complex mediates electron transfer between photosystem II and photosystem I while also contributing to the generation of a proton gradient across the thylakoid membrane. The protein is encoded in the chloroplast genome, which contains approximately 95-100 genes total . The petD protein functions as an integral membrane protein within the cytochrome complex and requires proper interaction with nuclear-encoded proteins for optimal function.

How is the petD gene organized in the chloroplast genome of Helianthus annuus?

In sunflower, the petD gene is located within the chloroplast genome as part of a gene cluster containing other photosynthesis-related genes. The gene typically contains an intron that splits the coding sequence into two exons. This structure is consistent with other chloroplast genes that require specific nuclear-encoded factors for proper splicing and expression. The organization of chloroplast genes, including petD, is of particular interest in evolutionary studies of Helianthus species, as chloroplast genomes show clear distinctions between annual and perennial species .

What evolutionary relationships can be inferred from petD sequence analysis across Helianthus species?

Comparative analysis of petD sequences across Helianthus species reveals important evolutionary patterns:

Species TypeSequence DivergenceNotable Features
Annual species (H. annuus, H. petiolaris)Minimal (>99% identity)Highly conserved coding regions
Perennial species (H. maximiliani, H. giganteus)Moderate (97-98% identity)More sequence variations, especially in non-coding regions

These patterns align with broader phylogenetic analyses showing three major clades in Helianthus: a large annual clade, a southeastern perennial clade, and another clade of primarily large-statured perennials . The greater sequence divergence in perennial species correlates with the cytonuclear incompatibilities observed when perennial cytoplasms are combined with annual nuclear genomes.

What are the optimal methods for isolating chloroplast DNA to study petD in sunflower?

For high-quality chloroplast DNA isolation from Helianthus annuus:

  • Harvest young leaves (preferably at the V4 stage) early in the morning when starch content is low .

  • Homogenize tissue in isolation buffer (330 mM sorbitol, 30 mM HEPES, 2 mM EDTA, pH 7.6).

  • Filter through miracloth to remove debris.

  • Differential centrifugation to separate chloroplasts (1000g for 5 minutes).

  • Treat isolated chloroplasts with DNase I to eliminate nuclear DNA contamination.

  • Lyse purified chloroplasts with 2% CTAB buffer.

  • Extract DNA using phenol:chloroform:isoamyl alcohol (25:24:1).

  • Precipitate with isopropanol and wash with 70% ethanol.

  • Store DNA at -80°C in TE buffer or similar preservation solution .

This method typically yields 5-10 μg of chloroplast DNA from 10 g of fresh leaf tissue, with minimal nuclear DNA contamination.

What expression systems are most effective for producing recombinant sunflower petD protein?

Expressing membrane proteins like petD presents unique challenges that require specialized approaches:

Expression SystemAdvantagesDisadvantagesYield (mg/L)
E. coli C41(DE3)Cost-effective, scalablePotential misfolding0.5-1.0
E. coli with membrane fractionsBetter foldingMore complex purification0.8-1.5
Cell-free systemAvoids toxicity issuesHigher cost, lower yield0.2-0.5
Yeast (P. pastoris)Better post-translational processingLonger production time1.0-2.0

For membrane proteins like petD, expression in E. coli C41(DE3) strain at reduced temperatures (18°C) with specialized membrane protein tags (such as SUMO or MBP) typically provides the best balance of yield and proper folding.

How can circular dichroism spectroscopy be used to verify proper folding of recombinant petD?

Circular dichroism (CD) spectroscopy provides crucial information about recombinant petD protein folding:

  • Prepare purified petD protein at 0.1-0.2 mg/mL in detergent buffer.

  • Scan wavelength range 190-260 nm at 20°C using 0.1 cm pathlength cuvettes.

  • Analyze alpha-helical content using spectral deconvolution software.

  • Compare with reference spectra for properly folded cytochrome complex proteins.

  • Expected results for functional petD:

    • Strong negative bands at 208 and 222 nm (alpha-helical signature)

    • Calculated alpha-helical content approximately 60-65%

    • Thermal stability measurements showing cooperative unfolding

Significant deviations from these patterns indicate improper folding that will impact functional studies.

How do cytonuclear interactions involving petD differ between annual and perennial Helianthus species?

Research shows distinct patterns of cytonuclear interactions involving chloroplast genes like petD:

  • Compatibility patterns:

    • Annual cytoplasm × annual nuclear genome: Compatible, normal phenotype

    • Annual cytoplasm × perennial nuclear genome: Generally compatible

    • Perennial cytoplasm × annual nuclear genome: Often incompatible, showing reduced vigor

    • Perennial cytoplasm × perennial nuclear genome: Compatible, normal phenotype

  • Molecular mechanisms:

    • Nuclear-encoded factors interact with chloroplast genes including petD

    • Splicing efficiency of chloroplast gene introns differs between compatible and incompatible combinations

    • Translation efficiency of chloroplast mRNAs varies in different cytonuclear backgrounds

  • Vigor restoration:

    • Single dominant nuclear genes can restore vigor in incompatible combinations

    • These "V" genes are located at the same locus (V1) in multiple cultivated lines

    • Vigor restoration genes are common in cultivated sunflower germplasm

These interactions demonstrate the complex evolutionary relationships between nuclear and cytoplasmic genomes in Helianthus species.

What phenotypic changes occur in plants with petD expression defects?

Defects in petD expression result in characteristic phenotypic changes similar to those observed in cytonuclear incompatible plants:

PhenotypeSeverityPhysiological Impact
Pale-green leavesModerate to severeReduced chlorophyll content, impaired photosynthesis
Reduced plant heightSignificant (30-50% reduction)Decreased biomass production
Smaller head diameterModerate (20-30% reduction)Reduced reproductive capacity
Lower seed weightSignificant (40-60% reduction)Decreased yield
Reduced percent seed setSevere (up to 70% reduction)Impaired fertility
Delayed flowering7-14 days later than normalAltered development timing

These phenotypes closely resemble the reduced-vigor plants observed in crosses between perennial Helianthus cytoplasms and annual nuclear genomes , suggesting that petD may be involved in these cytonuclear interactions.

How can site-directed mutagenesis of petD help understand cytonuclear interactions?

Site-directed mutagenesis of petD provides valuable insights into cytonuclear interactions:

  • Target selection:

    • Identify amino acid differences between annual and perennial Helianthus petD sequences

    • Focus on transmembrane domains and protein-protein interaction regions

    • Select residues that correlate with compatibility/incompatibility patterns

  • Mutagenesis strategy:

    • Introduce perennial-specific residues into annual petD sequence

    • Create chimeric constructs with domains from different species

    • Use degenerate codon libraries to explore functional constraints

  • Functional assessment:

    • Reconstitute mutated petD into liposomes with purified cytochrome complex components

    • Measure electron transfer rates using artificial electron donors/acceptors

    • Correlate electron transfer efficiency with specific sequence variations

  • In vivo validation:

    • Transform mutated petD into chloroplasts using biolistic methods

    • Evaluate phenotypic effects in various nuclear backgrounds

    • Correlate molecular changes with vigor phenotypes

This approach can identify specific regions of petD involved in cytonuclear interactions and advance our understanding of evolutionary constraints on this essential protein.

How can CRISPR-Cas9 technology be applied to modify petD in sunflower chloroplasts?

Modifying chloroplast genes like petD using CRISPR-Cas9 requires specialized approaches:

  • Chloroplast transformation strategy:

    • Design plastid-targeted Cas9 with transit peptide

    • Express from nuclear genome

    • Co-deliver guide RNAs targeting petD

    • Include selectable marker gene (e.g., aadA for spectinomycin resistance)

  • Guide RNA design considerations:

    • PAM site limitations in AT-rich chloroplast genome

    • Avoid off-targets in nuclear genome

    • Target conserved regions of petD

  • Transformation protocol:

    • Prepare gold particles (0.6 μm) coated with vector DNA

    • Bombard young leaf tissue using biolistic method

    • Culture on medium with spectinomycin selection

    • Screen for heteroplasmy using restriction fragment length polymorphism

    • Regenerate plants through tissue culture

    • Select for homoplasmy through several rounds of regeneration

  • Validation methods:

    • PCR and sequencing of target region

    • Western blot analysis of petD protein

    • Electron transport rate measurements

    • Phenotypic analysis of transformants

This approach allows precise engineering of petD to study structure-function relationships and potentially enhance photosynthetic efficiency.

What high-resolution structural techniques can reveal petD interactions within the cytochrome b6-f complex?

Advanced structural techniques provide critical insights into petD protein interactions:

These complementary approaches can map the precise interactions between petD and other subunits of the cytochrome b6-f complex, revealing the molecular basis of cytonuclear incompatibilities observed in interspecific hybrids.

How does petD contribute to photosynthetic efficiency in high-yielding sunflower varieties?

The role of petD in high-yielding sunflower varieties involves several key aspects:

  • Electron transport capacity:

    • Cytochrome b6-f complex often represents the rate-limiting step in photosynthetic electron transport

    • High-yielding varieties show 15-25% higher electron transport rates

    • Increased capacity correlates with enhanced carbon fixation

  • Regulatory functions:

    • The cytochrome complex participates in signaling pathways that regulate photosynthetic gene expression

    • Efficient state transitions allow better adaptation to changing light conditions

    • Enhanced control of electron flow between photosystems improves energy conversion efficiency

  • Stress tolerance:

    • Proper cytochrome b6-f function maintains redox balance under stress conditions

    • High-yielding varieties show better maintenance of photosynthetic efficiency under heat and drought

    • Reduced photoinhibition during environmental fluctuations

How can synthetic biology approaches be used to engineer optimal petD variants for improved photosynthesis?

Synthetic biology offers promising approaches for petD engineering:

  • Design principles:

    • Optimize codon usage for chloroplast expression

    • Enhance protein stability while maintaining flexibility for conformational changes

    • Modify residues at rate-limiting steps in electron transfer

  • Testing platforms:

    • Reconstitution in nanodiscs for in vitro functional assessment

    • Chloroplast transformation for in vivo validation

    • High-throughput screening using fluorescence-based electron transport assays

  • Engineering strategies:

    • Directed evolution with selection for faster electron transport

    • Computational design based on quantum mechanical models of electron transfer

    • Domain swapping with more efficient homologs from other species

  • Performance metrics:

    • Electron transfer rate (μmol electrons m⁻² s⁻¹)

    • ATP/NADPH ratio optimization

    • Carbon fixation rate enhancement

    • Stress tolerance improvement

These approaches could yield petD variants with improved photosynthetic efficiency, potentially contributing to enhanced crop productivity.

What role might petD play in the adaptation of wild Helianthus species to diverse environments?

The petD gene likely contributes to environmental adaptation in wild Helianthus species:

  • Thermal adaptation:

    • Sequence variations correlate with habitat temperature ranges

    • Species from hotter environments show modifications in transmembrane domains

    • Thermostability of the cytochrome complex varies among species from different climates

  • Light adaptation:

    • Regulatory regions show differences between shade-adapted and sun-exposed species

    • Electron transport capacity correlates with typical light intensity in native habitats

    • State transition capabilities differ between forest edge and open field species

  • Drought response:

    • Desert-adapted species maintain cytochrome function under water limitation

    • Variations in protein stability under dehydration stress

    • Differential regulation during drought-induced dormancy

The study of wild Helianthus petD variants provides valuable insights for crop improvement, particularly for developing sunflower varieties with enhanced environmental resilience. The cytonuclear interactions observed in interspecific crosses highlight the importance of coordinated evolution between nuclear and chloroplast genomes in adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.