Recombinant Helianthus annuus Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

Cytochrome b6 (petB) is a core subunit of the cytochrome b6f complex, a 220 kDa dimeric structure central to:

  • Linear Electron Transport: Transfers electrons from PSII to PSI, generating ATP and NADPH .

  • Cyclic Electron Transport: Maintains proton gradients for ATP synthesis via PSI .

  • State Transitions: Regulates light energy distribution between PSII and PSI .

Subunit Composition of the Cytochrome b6f Complex

SubunitGene OriginRoleReferences
PetAChloroplastCytochrome f (electron carrier)
PetBChloroplastCytochrome b6 (heme-binding, electron transfer)
PetCNuclearRieske iron-sulfur protein (electron transfer)
PetDChloroplastScaffold for complex assembly
PetGChloroplastEssential for complex stability
PetLChloroplastStabilizes complex dimerization
PetMNuclearRegulates complex biogenesis
PetNChloroplastStabilizes subunit interactions (critical in cyanobacteria)

Key Findings:

  • Electron Transport Efficiency: The cytochrome b6f complex acts as a rate-limiting step in RuBP regeneration, influencing photosynthetic flux .

  • State Transitions: Deletion of PetN in cyanobacteria abolishes state transitions, highlighting the complex’s role in light adaptation .

Genetic Engineering for Improved Photosynthesis

Patents ( ) describe strategies to overexpress RieskeFeS protein (PetC) or cytochrome b6 (PetB) to enhance electron transport efficiency. For example:

  • Overexpression of PetC: Increases linear electron flux and ATP/NADPH production, bypassing bottlenecks in the cytochrome b6f complex .

  • Co-regulation of ATP Synthase: Combined upregulation of PetC and ATP synthase subunits (e.g., AtpD) optimizes proton gradient utilization .

Biochemical Studies

  • Destabilization of PetN: Loss of PetN in cyanobacteria reduces cytochrome b6f stability, linking small subunits to complex integrity .

  • Electron Transfer Kinetics: Mutational studies in Arabidopsis and cyanobacteria reveal that PetB’s transmembrane helices mediate monomer-monomer interactions .

Expression and Purification

StepDetails
HostE. coli (e.g., BL21(DE3) or Rosetta-gami2)
Induction0.5 mM IPTG at 30°C for soluble protein production
PurificationMetal-affinity chromatography (His-tag) followed by dialysis
StorageAliquoted at -20°C/-80°C; avoid repeated freeze-thaw cycles

Handling Notes

  • Reconstitution: Use deionized water to 0.1–1.0 mg/mL; add 5–50% glycerol for long-term storage .

  • Stability: Lyophilized powder retains activity for months at -20°C/-80°C .

Comparative Analysis with Other Species

SpeciesUniProt IDLength (aa)Key Divergence
Helianthus annuusQ1KXS9215Chloroplast-encoded, His-tagged
Prochlorothrix hollandicaP28058222Marine cyanobacteria, longer C-terminal
Oryza nivaraQ6ENE4N/ARice variant with conserved heme motifs

Divergence Insights:

  • Heme-Binding Motifs: Conserved in all species, but Prochlorothrix shows extended C-terminal regions .

  • Electron Transport Efficiency: Plant variants (e.g., Helianthus) exhibit higher flux control coefficients compared to cyanobacteria .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: han:4055689

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of cytochrome b6 (petB) in photosynthetic organisms like Helianthus annuus?

Cytochrome b6, encoded by the petB gene, is a critical component of the cytochrome b6f complex that plays pivotal roles in both linear and cyclic electron transport during oxygenic photosynthesis. This multi-subunit complex catalyzes the oxidation of quinols and the reduction of plastocyanin, establishing the proton force required for ATP synthesis . In sunflower and other plants, cytochrome b6 contains multiple heme groups that facilitate electron transport between photosystem II and photosystem I. The protein contains both b-type and c-type cytochromes with three heme groups, making it essential for photosynthetic energy conversion . Disruption of the cytochrome b6f complex significantly reduces oxygen evolution activity, which can be partially restored by adding artificial electron carriers like TMPD that bypass the complex .

How is the petB gene organized in the chloroplast genome of Helianthus annuus?

The petB gene in Helianthus annuus, like in other photosynthetic organisms, is encoded in the chloroplast genome. It belongs to a group of chloroplast genes involved in photosynthetic electron transport, including petA (encoding cytochrome f), petB (encoding cytochrome b6), and petD (encoding subunit IV) . In many plants, the petB and petD transcripts undergo processing after transcription, which is necessary for proper expression . The gene organization is conserved across plant species, with the petB gene typically located in a gene cluster that includes other photosynthetic components. Transcriptional analysis shows that these genes are co-regulated to ensure proper stoichiometric assembly of the cytochrome b6f complex components.

What expression systems are most suitable for producing recombinant Helianthus annuus cytochrome b6?

Multiple expression systems can be employed for producing recombinant cytochrome b6, each with distinct advantages:

Expression SystemAdvantagesLimitationsYieldProcessing Time
E. coliHigh yields, simple protocol, cost-effectiveLimited post-translational modifications★★★★★★★★★
YeastGood yields, some post-translational modificationsMore complex than E. coli★★★★★★★
Insect cellsBetter post-translational modifications, protein foldingLower yields, more expensive★★★★
Mammalian cellsBest for complex modifications, native-like foldingLowest yields, most expensive, time-consuming

E. coli and yeast systems offer the best yields and shorter turnaround times for recombinant cytochrome b6 production . For functional studies requiring proper folding and heme incorporation, insect cells with baculovirus or mammalian cells provide many of the post-translational modifications necessary for correct protein folding and retention of the protein's activity . For structural studies requiring large protein quantities, E. coli-based systems optimized for membrane protein expression are typically preferred.

What purification methods are most effective for recombinant Helianthus annuus cytochrome b6?

Purification of recombinant cytochrome b6 typically employs affinity chromatography strategies. The protein can be produced with fusion tags such as His-tags that facilitate purification through immobilized metal affinity chromatography (IMAC) . For example, expressing cytochrome b6 as a fusion protein with thioredoxin and a His-tag (resulting in approximately 35 kDa fusion protein) enables efficient purification through nickel-chelating columns . After initial affinity purification, the fusion tags can be removed using appropriate proteases (such as enterokinase), followed by size exclusion chromatography to obtain the pure native-sized protein. Throughout the purification process, it's crucial to monitor the presence of heme groups through spectroscopic methods to ensure the purified protein maintains its structural integrity and capacity for electron transport.

How does the assembly mechanism of recombinant cytochrome b6 differ from native assembly in Helianthus annuus chloroplasts?

The assembly of cytochrome b6 involves a complex interplay between protein folding and cofactor incorporation. In native chloroplasts, cytochrome b6 assembly is coordinated with the synthesis of other components of the cytochrome b6f complex. In contrast, recombinant expression often results in uncoordinated production that can affect proper assembly.

Research has revealed that heme binding in cytochrome b6 occurs in a sequential, ordered process. The low-potential heme b(L) must bind first, serving as a prerequisite for the subsequent binding of the high-potential heme b(H) . This sequential assembly mechanism depends on specific histidine residues that serve as axial ligands for the heme molecules. Notably, His86 is critical for binding heme b(L), as its substitution prevents all heme binding. In contrast, substitution of His187 (another heme b(L) ligand) still permits binding of both hemes .

Similarly for heme b(H), substitution of His202 allows only heme b(L) binding, while replacement of His100 still enables binding of both hemes . This indicates that particular histidine residues within each pair of heme ligands have differential importance during assembly. When designing recombinant expression systems, these hierarchical assembly requirements must be considered to obtain functional protein with properly incorporated cofactors.

What structural and functional differences exist between recombinant Helianthus annuus cytochrome b6 and its homologs in cyanobacteria and other photosynthetic organisms?

While the core structure of cytochrome b6 is conserved across photosynthetic organisms, species-specific variations affect its functional properties and interactions within the cytochrome b6f complex:

SpeciesStructural FeaturesFunctional Implications
Helianthus annuus (sunflower)Four transmembrane helices, two b-type hemes, one additional hemeAdapted for higher plant photosynthesis environments
Anabaena variabilisSimilar core structure with species-specific surface residuesFunctions in both heterocysts and vegetative cells
Chlamydomonas reinhardtiiAdditional N-terminal region involved in complex assemblyAllows for adaptable photosynthetic responses
Synechocystis sp.Contains unique loop regions that affect quinone bindingAdapted for cyanobacterial electron transport

These structural differences affect protein-protein interactions within the cytochrome b6f complex. For example, in cyanobacteria like Anabaena variabilis, the cytochrome b6f complex contains four large subunits responsible for organizing the electron transfer chain and four small subunits unique to oxygenic photosynthesis . The loss of small subunits, such as PetN, can destabilize the entire complex, reducing the amount of large subunits to 20-25% of wild-type levels . Understanding these differences is crucial when using recombinant systems, as the expression host may lack specific chaperones or assembly factors required for proper folding and function.

How do mutations in the heme-binding domains of recombinant Helianthus annuus cytochrome b6 affect protein stability and function?

Mutations in the heme-binding domains dramatically affect both the assembly and function of cytochrome b6. Experimental evidence with recombinant cytochrome b6 has demonstrated that the four histidine residues serving as axial ligands for the two heme groups (b(L) and b(H)) have hierarchical roles in protein stability:

  • His86 mutations: When this heme b(L) axial ligand is substituted, the apo-protein completely loses its ability to bind heme, resulting in an unstable protein lacking all heme incorporation .

  • His187 mutations: Despite being another axial ligand for heme b(L), substitution of this residue still allows binding of both hemes, indicating its secondary role in the assembly process .

  • His202 mutations: Substitution of this heme b(H) axial ligand permits binding of only heme b(L), confirming the sequential nature of heme incorporation .

  • His100 mutations: Despite serving as an axial ligand for heme b(H), replacement of this residue still allows binding of both hemes .

These findings reveal that the sequential binding of hemes is essential for proper cytochrome b6 assembly, with heme b(L) binding being a critical prerequisite for subsequent heme b(H) incorporation. Furthermore, studies of the midpoint potentials of various cytochrome b6 variants indicate a cooperative adjustment of heme redox properties, demonstrating that mutations affecting one heme can influence the electrochemical properties of the other . These structure-function relationships are crucial for designing site-directed mutagenesis experiments and understanding electron transport mechanisms in photosynthetic organisms.

What role does the nuclear genome play in the expression and assembly of recombinant Helianthus annuus cytochrome b6?

While the petB gene encoding cytochrome b6 is located in the chloroplast genome, the nuclear genome plays a crucial role in regulating its expression and assembly into the functional cytochrome b6f complex. The nuclear genome encodes several factors that affect cytochrome b6 production:

  • Nuclear-encoded RNA processing factors that regulate the splicing and processing of chloroplast transcripts, including petB mRNA.

  • Translation factors specific for chloroplast gene expression.

  • Chaperones and assembly factors that facilitate proper folding and incorporation of heme groups.

  • The Rieske Fe-S protein (encoded by nuclear petC), which is essential for cytochrome b6f complex assembly.

Studies with mutants have shown that deficiencies in nuclear-encoded components can dramatically affect cytochrome b6f complex formation. For example, analysis of the Lemna perpusilla mutant No. 1073 revealed that while chloroplast genes for cytochrome f, cytochrome b6, and subunit IV were transcribed normally, the level of translationally active mRNA for the nuclear-encoded Rieske Fe-S protein was reduced by more than 100-fold . This resulted in the mutant containing less than 1% of the four protein subunits compared to wild-type strains . This intergenomic coordination highlights the complex regulatory network governing photosynthetic complex assembly and emphasizes the importance of considering both chloroplast and nuclear factors when designing recombinant expression strategies.

How can researchers optimize heme incorporation during recombinant expression of Helianthus annuus cytochrome b6?

Optimizing heme incorporation during recombinant expression of cytochrome b6 requires several strategic approaches:

The sequential nature of heme incorporation (heme b(L) must be incorporated before heme b(H)) means that optimizing conditions for the initial heme binding is critical . Expression in host systems with enhanced capacity for membrane protein production and cofactor insertion, such as Rosetta-gami2 (DE3) pLysS strain, has shown success for other recombinant proteins and could be applied to cytochrome b6 . Spectroscopic analysis during purification is essential to monitor the heme:protein ratio and ensure proper incorporation of all cofactors necessary for functional activity.

What methods can be used to assess the functional integrity of recombinant Helianthus annuus cytochrome b6?

Several complementary techniques can verify the functional integrity of recombinant cytochrome b6:

  • Spectroscopic analysis: UV-visible absorption spectroscopy can confirm proper heme incorporation by examining characteristic peaks at approximately 414 nm (Soret band), 532 nm, and 562 nm. Reduced minus oxidized difference spectra provide additional confirmation of functional heme groups.

  • Redox potential measurements: Determining the midpoint potentials of both heme b(L) and heme b(H) using techniques such as potentiometric titration can verify proper electrochemical properties. Functional recombinant cytochrome b6 should display cooperative adjustment of heme midpoint potentials similar to the native protein .

  • Proteoliposome-based electron transfer assays: Reconstituting recombinant cytochrome b6 with other components of the cytochrome b6f complex in liposomes allows measurement of electron transfer rates using artificial electron donors and acceptors.

  • Inhibitor sensitivity testing: Functional cytochrome b6 should display characteristic sensitivity to inhibitors such as 2,5-dibromo-3-methyl-6-isopropylbenzoquinone, which specifically targets the cytochrome b6f complex .

  • Structural integrity assessment: Circular dichroism spectroscopy can confirm proper secondary structure content, while blue native PAGE can assess the ability of recombinant cytochrome b6 to assemble into higher-order complexes .

  • Reconstitution experiments: Complementation studies using cytochrome b6f-deficient mutants, such as the ΔpetN mutant of Anabaena variabilis, can provide functional validation of recombinant protein activity in vivo .

How does the stability of recombinant Helianthus annuus cytochrome b6 compare to native protein when exposed to various experimental conditions?

The stability of recombinant versus native cytochrome b6 can vary significantly under experimental conditions, with important implications for research applications:

ConditionNative Protein StabilityRecombinant Protein StabilityExperimental Considerations
Temperature (4-37°C)Stable up to 35°COften less thermostableStore at 4°C; avoid freeze-thaw cycles
pH range (5.0-9.0)Optimal stability pH 6.5-7.5Narrower stability rangeBuffer at physiological pH
Detergent exposureTolerates mild detergentsHigher sensitivity to detergent denaturationUse gentler detergents (DDM vs. SDS)
Ionic strengthStable in moderate saltMay require higher salt for stabilityInclude 100-200 mM NaCl in buffers
Freeze-thaw cyclesModerately resistantSignificantly decreased stabilityAliquot and avoid repeated freezing
Light exposurePhotosensitiveHighly photosensitiveStore in amber containers

Native cytochrome b6 benefits from interactions with other subunits of the cytochrome b6f complex, which stabilize its structure and protect the heme groups from oxidation. The recombinant protein often lacks these stabilizing interactions, particularly when expressed without its partner subunits. When designing experiments with recombinant cytochrome b6, researchers should implement stabilizing measures such as including glycerol (10-15%) in storage buffers, using oxygen scavengers to prevent heme oxidation, and storing the protein in the dark at 4°C to maintain its functional integrity.

What are the most effective strategies for studying protein-protein interactions involving recombinant Helianthus annuus cytochrome b6?

Studying protein-protein interactions involving recombinant cytochrome b6 requires specialized approaches that account for its transmembrane nature and cofactor requirements:

  • Co-expression systems: Simultaneous expression of cytochrome b6 with its interaction partners (such as subunit IV, cytochrome f, or the Rieske protein) can facilitate complex formation. Evidence from mutant studies indicates that the Rieske Fe-S protein plays a key role in stabilizing the cytochrome b6f complex, making it a prime candidate for co-expression studies .

  • Blue native PAGE (BN-PAGE): This technique preserves protein complexes during electrophoresis and has been successfully used to analyze cytochrome b6-containing complexes . BN-PAGE followed by second-dimension SDS-PAGE can identify specific interaction partners.

  • Crosslinking mass spectrometry: Chemical crosslinking combined with mass spectrometry can identify points of contact between cytochrome b6 and its interaction partners, providing structural insights into complex assembly.

  • Surface plasmon resonance (SPR): For studying dynamic interactions, SPR with recombinant cytochrome b6 reconstituted in nanodiscs or liposomes can measure binding kinetics with soluble partners like plastocyanin.

  • Fluorescence resonance energy transfer (FRET): Site-specific labeling of recombinant cytochrome b6 and potential interaction partners with fluorescent probes can reveal proximity relationships and conformational changes during complex assembly.

  • Cryo-electron microscopy: For structural studies of larger complexes, cryo-EM of recombinant cytochrome b6 assembled with partner proteins can provide insights into the architecture of the complete cytochrome b6f complex.

Research with mutants has demonstrated that disruption of complex assembly can lead to increased protein turnover, as observed with subunit IV in the Lemna perpusilla mutant, which showed a 10-fold higher rate of protein turnover when the Rieske Fe-S protein was unavailable . This highlights the importance of proper complex formation for protein stability and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.