Recombinant Helianthus annuus Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant COX3 is expressed in Escherichia coli with an N-terminal His-tag for affinity purification . Specifications include:

ParameterDetails
Expression SystemE. coli
Purification MethodNickel-affinity chromatography; >90% purity confirmed by SDS-PAGE
FormulationLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; reconstitution in sterile water (0.1–1.0 mg/mL) with 50% glycerol

Research Applications

  • CMS Mechanism Studies: Recombinant COX3 aids in dissecting mitochondrial-nuclear interactions in sunflower CMS systems, particularly in lines like ANN2 where orf1197 (a chimeric atp6-derived gene) disrupts Complex IV assembly .

  • Structural Biology: Used in crystallography and membrane protein studies to map proton translocation pathways .

  • Agricultural Biotechnology: Serves as a reference protein for developing fertility-restorer lines in hybrid sunflower breeding .

Challenges and Considerations

  • Instability: Repeated freeze-thaw cycles degrade the protein; aliquoting is recommended .

  • Species Specificity: Sunflower COX3 shares <40% homology with human COX3 (UniProt P00414), limiting cross-species applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
COX3; COXIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
COX3
Target Protein Sequence
MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHSFQGGATLLSLGLIFILYTMFVW WRDVLRESTLEGHHTKVVQLGPRYGFILFIVSEVMFLFALFRASSHSSLAPTVEIGGIWP PKGIAVLDPREIPFLNTPIPLSSGAAVTWAHHAILAGKEKRAVYALVATVSLALVFTAFQ GMEYYQAPSTISDSIYGSTFFLATGFHGFHVIIGTLFSIVCGIRQYLGHLTKEHHVGFEA AAWYWHFVDVVRLFPFVSIYWWGGI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. This chain consists of three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane that powers transmembrane transport and ATP synthase. Cytochrome c oxidase, the final component of the respiratory chain, catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Helianthus annuus Cytochrome c oxidase subunit 3 (COX3)?

Helianthus annuus COX3 is one of the three core subunits of the aa3-type cytochrome c oxidase derived from common sunflower (Helianthus annuus) . It is also known as Cytochrome c oxidase polypeptide III and is encoded by genes designated as COX3 or COXIII . Unlike other subunits involved in electron transfer, COX3 does not contain any redox centers but plays a significant role in the biosynthesis of the enzyme complex . The recombinant form is produced in expression systems such as E. coli, yeast, baculovirus, or mammalian cells to provide a purified protein for research applications .

What are the optimal storage conditions for recombinant Helianthus annuus COX3?

For optimal preservation of recombinant Helianthus annuus COX3 activity and structural integrity, the protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein . For extended storage periods, conservation at -80°C is recommended . To minimize protein degradation from repeated freeze-thaw cycles, it's advisable to prepare working aliquots that can be stored at 4°C for up to one week . This approach prevents the structural changes and activity loss that can occur during multiple freeze-thaw cycles while maintaining the protein in a stable environment suitable for experimental consistency.

How is the expression of cytochrome c regulated in different tissues of Helianthus annuus?

RNA in situ hybridization studies have revealed that cytochrome c expression in Helianthus annuus exhibits distinct tissue-specific and developmental stage-dependent patterns despite showing relatively consistent transcript levels in northern-blot analyses . Enhanced expression is observed in floral meristems as soon as they become distinguishable from the central portion of the capitulum containing the inflorescence meristem . During early flower development, labeling is detected in all developing floral organ primordia, but as development progresses, expression in petals decreases while the central portion of the flower maintains strong expression .

The most notable tissue-specific expression occurs during reproductive organ development. During stamen formation, hybridization signals are predominantly localized in anthers . In less developed flowers, expression extends throughout the archesporial tissue, while during meiosis, expression becomes concentrated primarily in tapetal cells . This cell-type-specific expression pattern in reproductive tissues suggests a critical role for cytochrome c in the high-energy-demanding processes of pollen development, similar to patterns observed for other mitochondrial proteins in sunflower .

What methods are most effective for studying tissue-specific expression of COX3 in Helianthus annuus?

Based on successful previous studies with cytochrome components in Helianthus annuus, the most effective methodological approaches for studying tissue-specific expression include:

  • RNA in situ hybridization: This technique has proven particularly valuable for localizing COX3 transcripts in specific cell types and tissues during developmental processes, allowing visualization of expression patterns that would be missed in whole-tissue analyses .

  • Stage-specific tissue sampling: Collection of flowers at different developmental stages (R-3, R-4, R-5) enables examination of expression changes throughout floral development, particularly in reproductive structures .

  • Combined approach with promoter analysis: For comprehensive understanding, RNA hybridization can be complemented with promoter-reporter gene fusions (such as β-glucuronidase assays) to study the regulatory elements controlling expression patterns, as successfully employed for other mitochondrial components .

  • Comparative expression analysis: Correlating expression patterns of COX3 with other mitochondrial components (such as ATP synthase β-subunit) provides insights into coordinated regulation of the respiratory chain during development .

What is the functional role of subunit III in cytochrome c oxidase activity?

Contrary to earlier hypotheses, research has demonstrated that subunit III of cytochrome c oxidase is not directly involved in the proton pumping mechanism of the enzyme . Site-directed mutagenesis studies targeting the invariant carboxylic acids E98 (the DCCD-binding glutamic acid) and D259 of COIII revealed that structurally normal enzyme with full electron transfer activity can form in the presence of mutagenized COIII . Moreover, experiments with bacterial spheroplasts confirmed that these mutant oxidases retain complete proton translocation competence .

The primary functional significance of subunit III appears to be:

  • Assembly role: COIII plays a crucial role during the biosynthesis and assembly of the enzyme complex .

  • Structural stabilization: It contributes to the structural integrity of the enzyme, particularly for the active site .

  • Extended catalytic lifespan: Most critically, subunit III extends the catalytic lifespan of cytochrome c oxidase by approximately 600-fold by preventing "suicide inactivation" .

  • Proton uptake modulation: While not essential for proton pumping, subunit III influences the rate of proton uptake into the D pathway .

This revised understanding of subunit III function shifts focus from its direct catalytic involvement to its role in maintaining long-term enzyme stability and proper assembly, with significant implications for energy conservation at the cellular level .

What is "suicide inactivation" in cytochrome c oxidase and how does subunit III prevent it?

Suicide inactivation refers to a catastrophic self-destructive event at the heme a₃-CuB active site of cytochrome c oxidase that results in the irreversible loss of CuB during catalytic turnover . This phenomenon significantly shortens the enzyme's functional lifespan and occurs much more rapidly when subunit III is absent.

The relationship between subunit III and suicide inactivation is characterized by:

  • Magnitude of protection: Subunit III extends the catalytic lifespan (number of catalytic cycles until irreversible inactivation) of cytochrome c oxidase by 600-fold or more .

  • Mechanism of protection: Subunit III appears to prevent suicide inactivation by facilitating proper proton uptake into the D pathway. When subunit III is removed, proton uptake into this pathway becomes rate-limiting, increasing the probability of suicide inactivation .

  • Conservation across species: The protective effect of subunit III against suicide inactivation is not limited to bacterial oxidases but has also been demonstrated in rat liver and bovine heart cytochrome c oxidase, explaining the high evolutionary conservation of this subunit across species .

  • Linkage to proton uptake: The rate of proton uptake and the probability of suicide inactivation are mechanistically linked, such that measurements of catalytic lifespan can serve as an indicator of D pathway proton uptake efficiency .

This understanding of suicide inactivation provides a rationale for why subunit III is as well conserved as the core catalytic subunit I - it prevents the premature loss of this major energy-conserving enzyme, representing a significant selective advantage .

How can recombinant Helianthus annuus COX3 be utilized in experimental research designs?

Recombinant Helianthus annuus COX3 offers multiple experimental applications for researchers investigating fundamental aspects of plant bioenergetics and protein function:

  • Structural-functional studies: Using site-directed mutagenesis to modify conserved residues (such as E98 and D259) enables investigation of how specific amino acids contribute to protein function and interaction with other subunits .

  • Comparative analysis: The recombinant protein facilitates comparison of plant COX3 structure and function with homologs from bacterial and mammalian systems, providing evolutionary insights .

  • Reconstitution experiments: Researchers can conduct reconstitution experiments with COX3-depleted cytochrome c oxidase to examine how the addition of wild-type or modified recombinant COX3 affects enzyme assembly, stability, and activity .

  • Proton pathway investigation: The recombinant protein can be employed in experiments examining the role of COX3 in modulating proton uptake pathways, particularly when combined with specific inhibitors or under varying pH conditions .

  • Suicide inactivation prevention studies: By measuring catalytic lifespan in the presence of wild-type or modified recombinant COX3, researchers can explore mechanisms of suicide inactivation prevention and identify critical structural elements responsible for this protective effect .

These experimental approaches utilize recombinant Helianthus annuus COX3 to advance understanding of not only plant-specific aspects of cytochrome c oxidase function but also universal principles of membrane protein assembly and respiratory chain stability.

How do the properties of plant COX3 compare with those from bacterial and mammalian systems?

The following table presents a comparative analysis of COX3 properties across different biological systems:

PropertyPlant (Helianthus annuus) COX3Bacterial COX3Mammalian COX3
Role in proton pumpingNot directly involved in proton pumping Not an essential element of the proton pump Not essential for proton translocation
Effect on catalytic lifespanPrevents suicide inactivation Extends lifespan by ~600-fold Prevents inactivation during turnover
Expression patternTissue-specific, enhanced in reproductive structures Varies by bacterial speciesTissue-specific with high expression in metabolically active tissues
Response to DCCDContains DCCD-binding glutamic acid residue (E98) DCCD binding affects proton translocation Contains conserved DCCD-binding site
Assembly functionImportant for biosynthesis of enzyme complex Function during biosynthesis Critical for proper assembly

This comparative analysis reveals that the fundamental role of COX3 in preventing suicide inactivation and contributing to enzyme assembly is conserved across diverse biological systems, from bacteria to plants and mammals . This conservation underscores the critical importance of subunit III for the long-term stability of cytochrome c oxidase despite its dispensability for the core catalytic function .

What are the current methodological challenges in studying plant COX3 function?

Researchers face several methodological challenges when investigating plant COX3 function:

  • Subunit III instability: Due to the weak binding of subunit III, most preparations of bacterial aa3-type cytochrome c oxidases contain substoichiometric amounts of the subunit, which can introduce experimental variability, especially in mutant forms that further weaken the subunit I-III interaction .

  • Distinguishing assembly vs. direct functional effects: Separating the role of COX3 in enzyme assembly from its direct effects on enzyme function requires careful experimental design, potentially involving time-course studies and intermediate assembly state analyses .

  • Tissue-specific expression analysis: While northern-blot hybridization shows minimal variation in transcript levels, significant differences exist in cell-type-specific expression, requiring specialized techniques like RNA in situ hybridization to detect these patterns .

  • Pollen analysis limitations: Technical limitations have been reported in analyzing cytochrome c gene expression in mature pollen using current methodologies, necessitating alternative approaches for studying expression in these tissues .

  • Integration of data across species: Reconciling findings across different model systems (bacterial, plant, mammalian) remains challenging due to differences in experimental conditions, genetic backgrounds, and technical approaches .

Addressing these methodological challenges through improved techniques for subunit stabilization, more sensitive detection methods, and standardized comparative approaches would significantly advance our understanding of plant COX3 function in the broader context of cytochrome c oxidase biology.

What emerging research questions remain to be addressed regarding Helianthus annuus COX3?

Several critical research questions warrant further investigation to advance our understanding of Helianthus annuus COX3:

  • Molecular basis of suicide inactivation prevention: What specific structural features or interactions enable COX3 to prevent suicide inactivation of cytochrome c oxidase, and can these mechanisms be enhanced or engineered?

  • Plant-specific adaptations: How has plant COX3 evolved unique features compared to bacterial and mammalian homologs to accommodate the specific bioenergetic requirements of plant metabolism and development?

  • Developmental regulation mechanisms: What transcriptional and post-transcriptional mechanisms control the tissue-specific expression patterns observed during sunflower development, particularly in reproductive structures?

  • Stress response involvement: How does COX3 expression and function change under various environmental stresses (drought, temperature extremes, pathogen attack) that affect mitochondrial respiration in plants?

  • Interaction with plant-specific components: What are the molecular interactions between COX3 and plant-specific accessory subunits or assembly factors that might contribute to unique aspects of plant cytochrome c oxidase function?

Addressing these questions will require integrated approaches combining structural biology, molecular genetics, advanced imaging techniques, and systems biology to fully elucidate the multifaceted roles of COX3 in plant bioenergetics and development.

What novel methodological approaches could advance COX3 research?

Emerging technologies and methodological approaches that could significantly advance Helianthus annuus COX3 research include:

  • Cryo-electron microscopy: High-resolution structural analysis of intact plant cytochrome c oxidase complexes with and without COX3 could reveal critical interaction interfaces and conformational changes that explain the functional contributions of this subunit.

  • Single-molecule techniques: Applying single-molecule approaches to study the dynamics of COX3 association with the core complex and its influence on proton uptake pathways could provide mechanistic insights not accessible through ensemble measurements.

  • Genome editing in Helianthus annuus: Development of efficient CRISPR-Cas9 protocols for sunflower would enable precise genetic manipulation of COX3 and interacting components in the native plant system.

  • Tissue-specific proteomics: Advanced proteomics approaches focused on specific cell types during development could reveal co-regulated proteins and post-translational modifications that modulate COX3 function.

  • Computational modeling and simulation: Molecular dynamics simulations of proton movement through cytochrome c oxidase with and without COX3 could elucidate the atomic-level details of how this subunit influences proton uptake and prevents suicide inactivation.

These advanced methodological approaches, combined with the foundational knowledge established through previous studies, offer promising avenues for unraveling the complex functions of Helianthus annuus COX3 in plant bioenergetics and development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.