Recombinant Helianthus annuus Cytochrome c oxidase subunit 5C-1 (COX5C1)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics

COX5C1 is a mitochondrial protein encoded by the COX5C1 gene in sunflower. As a subunit of COX (Complex IV), it plays a critical role in maintaining the structural and functional integrity of the enzyme. Key properties include:

ParameterDescription
Uniprot IDQ8VY40
Sequence Length63 amino acids
AA SequenceMVGGRVAHPVLKGPSEVKELIIGSVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVQE
Molecular Weight~12 kDa (estimated)
LocalizationMitochondrial inner membrane
FunctionStabilizes COX structure and facilitates electron transfer to oxygen

Production and Purification

COX5C1 is synthesized via recombinant DNA technology. The production process involves:

  • Expression Systems: Typically heterologous systems (e.g., E. coli or yeast) due to mitochondrial localization challenges.

  • Purification: Affinity chromatography or protein-specific antibodies to isolate the recombinant protein.

  • Storage: Tris-based buffer with 50% glycerol, stored at -20°C or -80°C .

Key Suppliers (as of 2023):

SupplierLocationProduct Availability
CUSABIO TECHNOLOGY LLCChina50 µg vials

Functional Role in Mitochondrial Respiration

COX5C1 is essential for COX activity, which is central to oxidative phosphorylation. Its role includes:

  • Structural Support: Maintaining the heme and copper centers of COX.

  • Electron Transfer: Facilitating the transfer of electrons from cytochrome c to oxygen, producing water.

  • Regulation: Modulating COX assembly and stability, particularly under stress conditions .

In plants, COX dysfunction is linked to cytoplasmic male sterility (CMS), as seen in sunflower PET1-CMS lines, where mitochondrial mutations disrupt anther development and pollen viability .

Immunoassay Development

Recombinant COX5C1 is used in ELISA kits to detect its presence in biological samples. These kits employ:

  • Antibodies: Specific to COX5C1’s epitopes (e.g., monoclonal antibodies like 7H8.2C12) .

  • Applications: Studying mitochondrial biogenesis, CMS mechanisms, or plant stress responses .

Mitochondrial Disease Models

While COX5C1 is not directly studied in human diseases, insights from analogous subunits (e.g., COX5B in cryptorchidism) highlight its potential relevance in disorders involving mitochondrial dysfunction .

Plant Biotechnology

COX5C1’s role in CMS suggests applications in:

  • Breeding Programs: Developing male-sterile lines for hybrid seed production.

  • Stress Tolerance: Engineering crops with enhanced COX stability under environmental stress .

Challenges and Future Directions

  • Limited Data: Few studies focus explicitly on COX5C1; most research examines other COX subunits (e.g., COX5B, COX Va) .

  • Tissue-Specific Effects: In sunflower, COX dysfunction manifests only in anthers, suggesting tissue-specific regulatory mechanisms .

  • Diagnostic Tools: Development of SECM-based methods (as in COX deficiency detection) could provide novel assays for COX5C1 activity .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Important: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoted at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX5C1; Cytochrome c oxidase subunit 5C-1; Cytochrome c oxidase polypeptide Vc-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-63
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
COX5C1
Target Protein Sequence
MVGGRVAHPVLKGPSEVKELIIGSVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV VQE
Uniprot No.

Target Background

Function
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Database Links

UniGene: Han.42

Protein Families
Cytochrome c oxidase subunit 5C family
Subcellular Location
Mitochondrion inner membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.