Recombinant Helianthus annuus NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
ND3
Target Protein Sequence
MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRF YLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), it's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 (ND3) in Helianthus annuus?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrially-encoded subunit of Complex I in the electron transport chain of Helianthus annuus (sunflower). This protein plays a critical role in cellular respiration and energy production. Complex I (NADH:ubiquinone oxidoreductase) catalyzes the transfer of electrons from NADH to ubiquinone, which represents the first step in the respiratory chain. In mitochondrial systems, Complex I typically contains multiple subunits, with some encoded by mitochondrial DNA (including ND3) while others are nuclear-encoded and imported into the organelle . The ND3 subunit in sunflower contributes to the membrane-embedded hydrophobic domain of Complex I and is essential for proton translocation across the inner mitochondrial membrane.

How does ND3 structure compare between Helianthus annuus and other species?

The ND3 protein in Helianthus annuus shares structural similarities with other plant species but contains unique sequence variations reflecting its evolutionary adaptation. When comparing ND3 sequences across species, researchers typically find that the transmembrane domains are more conserved than loop regions. In mitochondrial protein complexes like NADH:ubiquinone oxidoreductase, the structure-function relationship is critical for proper assembly and activity. Based on comparative analyses with better-characterized systems such as bovine heart mitochondria, we can infer that sunflower ND3 maintains the core functional domains necessary for electron transport while exhibiting species-specific variations . Understanding these structural differences is crucial when designing recombinant expression systems that aim to produce functional ND3 protein.

What genomic resources are available for studying ND3 in Helianthus species?

Genomic resources for studying ND3 in Helianthus annuus have expanded significantly with recent advances in sunflower genomics. Researchers can access the complete mitochondrial genome sequence of cultivated sunflower, which includes the ND3 gene. Additional resources include transcriptomic databases from various sunflower tissues and developmental stages, as well as interspecific population data from crosses between H. annuus and related species such as H. tuberosus . When studying genetic diversity in ND3, researchers should consider both cultivated lines (such as HA 89 and HA 434) and wild populations, as these represent different genetic backgrounds with potentially significant variation in mitochondrial genes . Flow cytometry techniques similar to those used for nuclear genome analysis can be adapted for studying mitochondrial DNA content and can provide valuable insights into copy number variations of mitochondrial genes like ND3.

What expression systems are most effective for producing recombinant Helianthus annuus ND3?

The optimal expression system for recombinant Helianthus annuus ND3 depends on research objectives and downstream applications. For structural studies requiring large quantities of properly folded protein, eukaryotic expression systems often yield better results than prokaryotic systems due to the hydrophobic nature of ND3 and its integration into membrane complexes. Based on approaches used for similar mitochondrial proteins, researchers should consider the following expression systems:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coliRapid growth, low costPoor membrane protein folding0.5-2.0
Yeast (P. pastoris)Post-translational modifications, membrane integrationLonger expression time3.0-7.0
Insect cellsNative-like folding, complex assemblyHigher cost, technical complexity5.0-10.0
Plant cell culturesSpecies-specific modificationsSlow growth, lower yields1.0-3.0

For functional studies of ND3, co-expression with other Complex I subunits may be necessary to achieve proper folding and activity. When designing recombinant constructs, researchers should consider adding affinity tags that minimally interfere with protein folding while facilitating purification.

How can researchers validate the authenticity of recombinant Helianthus annuus ND3?

Validating recombinant Helianthus annuus ND3 requires multiple analytical approaches to confirm both identity and functionality. Mass spectrometry represents the gold standard for protein identification, similar to approaches used in complex I research in bovine mitochondria . Researchers should digest purified recombinant ND3 with trypsin and analyze the resulting peptides via electrospray mass spectrometry, comparing observed peptide masses with theoretical digestion patterns. Additionally, antibody-based detection methods can verify expression, though researchers may need to develop specific antibodies against sunflower ND3 or use cross-reactive antibodies from related species.

Functional validation requires assessing the protein's ability to integrate into Complex I and participate in electron transport. Activity assays measuring NADH oxidation rates in reconstituted systems provide critical evidence of functional integrity. Researchers should also evaluate membrane integration properties, as improper membrane association would indicate misfolding of this hydrophobic protein. Comparison with native ND3 isolated from sunflower mitochondria provides the most definitive validation of recombinant protein authenticity.

What techniques are most effective for studying ND3 mutations across Helianthus populations?

Studying ND3 mutations across Helianthus populations requires a combination of genomic and functional approaches. For large-scale genomic analysis, next-generation sequencing of mitochondrial DNA from diverse sunflower populations provides comprehensive mutation profiles. When working with interspecific populations, such as H. annuus × H. tuberosus hybrids, researchers should employ targeted sequencing approaches to ensure accurate mitochondrial DNA analysis despite nuclear DNA variations .

For functional characterization of identified mutations, site-directed mutagenesis of recombinant ND3 constructs allows systematic evaluation of specific amino acid substitutions. The following methodology is recommended:

  • Identify naturally occurring ND3 variants through population sequencing

  • Create recombinant constructs with specific mutations

  • Express mutant proteins in appropriate systems

  • Assess effects on:

    • Protein stability and folding

    • Integration into Complex I

    • Electron transport efficiency

    • ROS production levels

This integrated approach connects genomic diversity with functional consequences, providing insights into the adaptive significance of ND3 variations across sunflower populations adapted to different environments.

How should researchers analyze contradictions in ND3 activity data across different experimental systems?

Contradictory ND3 activity data across experimental systems often stems from methodological differences, sample preparation variations, or biological factors. When confronted with such contradictions, researchers should employ a systematic analytical framework:

  • Evaluate methodological differences using activity theory principles to identify contradictions between elements of research activity systems

  • Perform meta-analysis across studies using standardized metrics (specific activity, turnover number)

  • Identify potential sources of variance:

    • Membrane composition differences

    • Detergent effects on protein conformation

    • Presence/absence of other Complex I subunits

    • Post-translational modifications

Resolution of contradictions typically requires targeted experiments that directly compare conditions while controlling for confounding variables. As noted in activity theory research, contradictions can be analyzed by "zooming in" on specific relationships within the research system to identify underlying mechanistic differences . This approach is particularly valuable when comparing recombinant ND3 behavior to native protein activity or when assessing differences between sunflower varieties.

What statistical approaches are appropriate for analyzing ND3 sequence-function relationships?

Analyzing ND3 sequence-function relationships requires sophisticated statistical approaches that can handle multivariate data from both sequence and functional assays. Statistical methods should be selected based on the specific research questions and data structures:

For correlation studies linking sequence variations to functional parameters, researchers should employ:

  • Principal Component Analysis (PCA) to identify patterns in sequence variation

  • Multiple regression models to associate sequence features with functional measurements

  • Structural equation modeling for complex pathway analysis

When studying interspecific hybrid populations, correlation analyses between traits are particularly valuable. For example, in H. annuus × H. tuberosus hybrids, researchers found that certain traits can be selected for independently, suggesting that genetic mechanisms controlling different characteristics may not be tightly linked . Similar approaches can be applied to analyze correlations between ND3 sequence variations and functional parameters.

For evolutionary analyses, phylogenetic comparative methods provide rigorous frameworks for assessing how ND3 sequence changes correlate with functional adaptations across Helianthus species and populations.

How can researchers distinguish between functional and neutral variations in ND3 across Helianthus species?

Distinguishing between functional and neutral variations in ND3 across Helianthus species requires integration of evolutionary, structural, and biochemical data. A comprehensive analytical framework includes:

  • Evolutionary conservation analysis:

    • Calculate site-specific evolutionary rates

    • Identify sites under positive selection versus purifying selection

    • Compare conservation patterns across plant lineages

  • Structural impact prediction:

    • Map variations onto predicted structural models

    • Assess proximity to functional domains or interfaces

    • Evaluate changes in physicochemical properties

  • Experimental validation:

    • Express variants in recombinant systems

    • Measure specific activity parameters

    • Assess thermal stability and assembly efficiency

When analyzing interspecific populations, such as those derived from H. annuus × H. tuberosus crosses, researchers can leverage segregation patterns to connect genotype with phenotype . This approach has been successfully applied in sunflower breeding programs to identify adaptive traits and can be extended to mitochondrial genes like ND3. Flow cytometry techniques similar to those used for nuclear DNA content analysis can be adapted to assess mitochondrial DNA variations and copy number, providing additional insights into ND3 genetic diversity .

How does ND3 contribute to bioenergetic efficiency in cultivated versus wild Helianthus annuus?

ND3's contribution to bioenergetic efficiency likely differs between cultivated and wild Helianthus annuus due to selection pressures during domestication. Research on this topic should address:

  • Comparative analysis of mitochondrial respiration efficiency:

    • Oxygen consumption rates in isolated mitochondria

    • ATP synthesis coupling efficiency

    • Proton leak measurements

    • Reactive oxygen species production

  • Genetic basis of observed differences:

    • ND3 sequence comparisons between wild and cultivated varieties

    • Expression level variations

    • Co-evolution with nuclear-encoded Complex I subunits

The domestication of sunflower by North American Indigenous peoples resulted in significant genetic changes, including approximately 1,000 percent increases in seed size over the past 3,000 years through selective breeding . Similar selection pressures may have affected mitochondrial genes like ND3, potentially favoring variants that optimize energy production for increased seed development. Interspecific breeding programs between annual H. annuus and perennial H. tuberosus have demonstrated that certain traits can be selected for independently , suggesting that mitochondrial functions might also be improved through strategic breeding approaches.

What protocols are recommended for isolating functional mitochondria from Helianthus tissues for ND3 studies?

Isolating functional mitochondria from Helianthus tissues requires careful consideration of tissue type, developmental stage, and experimental endpoints. The following protocol outline incorporates sunflower-specific considerations:

  • Tissue selection:

    • Young leaves yield higher quality mitochondria with fewer interfering compounds

    • Developing seeds provide insight into energy metabolism during oil accumulation

    • Root tissues offer perspective on mitochondrial adaptation to soil conditions

  • Isolation procedure:

    • Homogenize tissue in mannitol-based buffer (0.4M mannitol, 1mM EGTA, 25mM MOPS)

    • Perform differential centrifugation (1,000g → 12,000g)

    • Purify through Percoll gradient (18%/23%/40%)

    • Assess integrity via cytochrome c oxidation test

  • Quality control metrics:

    • Respiratory control ratio >3.0 indicates well-coupled mitochondria

    • Protein-to-lipid ratio correlates with membrane integrity

    • ATP synthesis capacity confirms functional electron transport chain

For sunflower-specific adaptations, researchers should modify standard protocols to account for high levels of phenolic compounds and lipids in sunflower tissues. Adding polyvinylpyrrolidone (PVP) to isolation buffers helps adsorb phenolics, while BSA addition protects against fatty acid inhibition of respiratory complexes.

How can researchers develop effective antibodies against Helianthus annuus ND3?

Developing effective antibodies against Helianthus annuus ND3 presents challenges due to the protein's hydrophobic nature and potential species-specific epitopes. A systematic approach includes:

  • Epitope selection strategy:

    • Identify hydrophilic regions through computational prediction

    • Select sequences with minimal homology to other plant proteins

    • Consider synthetic peptides representing multiple epitopes

  • Immunization protocols:

    • Use KLH-conjugated peptides for immunogenicity

    • Employ multiple-host strategy (rabbit and chicken) for diverse antibody repertoires

    • Implement extended immunization schedule with interval boosts

  • Antibody validation techniques:

    • Western blot against both recombinant and native ND3

    • Immunoprecipitation of Complex I components

    • Immunohistochemistry to confirm mitochondrial localization

For researchers developing antibodies against sunflower ND3, prioritizing epitopes unique to Helianthus species enhances specificity. When possible, validate antibodies across both cultivated varieties (such as HA 89 and HA 434) and wild populations to ensure broad utility across research applications .

How might ND3 modifications contribute to hybrid vigor in interspecific Helianthus crosses?

The potential contribution of ND3 modifications to hybrid vigor in interspecific Helianthus crosses represents an exciting frontier for research. Investigations should focus on:

  • Mitochondrial inheritance patterns in hybrid populations:

    • Track maternal versus paternal mitochondrial contribution

    • Identify potential heteroplasmy in hybrids

    • Assess nuclear-mitochondrial interactions

  • Bioenergetic performance measurements:

    • Compare respiration efficiency between parents and hybrids

    • Measure growth rate correlations with mitochondrial parameters

    • Evaluate stress tolerance linked to respiratory function

Research on interspecific Helianthus annuus × Helianthus tuberosus populations has demonstrated successful hybridization between these species with retention of valuable traits from both parents . These interspecific populations show potential for developing perennial oil-seed sunflower varieties with improved agronomic characteristics. Similar approaches could be applied to study mitochondrial contributions to hybrid vigor, particularly focusing on how ND3 variants from different species might interact with nuclear genes to influence bioenergetic efficiency and plant performance.

What role might ND3 play in adaptation to environmental stresses in wild Helianthus populations?

ND3's potential role in environmental adaptation among wild Helianthus populations likely relates to optimizing energy metabolism under stress conditions. Research in this area should explore:

  • Correlation of ND3 variants with environmental gradients:

    • Temperature adaptation across latitudinal clines

    • Drought tolerance in xeric-adapted populations

    • Soil chemistry adaptations in specialized ecotypes

  • Functional characterization under stress conditions:

    • Measure Complex I activity under temperature extremes

    • Assess ROS production during drought simulation

    • Evaluate salt stress effects on proton pumping efficiency

  • Transgenic complementation studies:

    • Replace native ND3 with variants from stress-adapted populations

    • Measure changes in stress tolerance

    • Identify synergistic interactions with nuclear genes

Wild Helianthus populations have adapted to diverse ecological niches across North America, potentially developing specialized mitochondrial functions to support these adaptations. The genetic resources available from both wild Helianthus populations and interspecific breeding programs provide valuable material for studying how ND3 and other mitochondrial genes contribute to environmental adaptation .

How can CRISPR-based approaches be optimized for studying ND3 function in Helianthus annuus?

Optimizing CRISPR-based approaches for studying ND3 function in Helianthus annuus requires addressing the unique challenges of targeting mitochondrial DNA, which has traditionally been recalcitrant to direct CRISPR editing. A comprehensive research strategy should include:

  • Alternative targeting strategies:

    • Nuclear-encoded mitochondrial-targeted TALE-TFs to modulate expression

    • RNA-targeting CRISPR systems for transcript modification

    • Allotopic expression of modified ND3 from nuclear genome

  • Delivery optimization for sunflower tissues:

    • Protoplast-based transformation efficiency comparison

    • Agrobacterium-mediated delivery parameters

    • Biolistic transformation for organelle targeting

  • Validation approaches:

    • RT-qPCR for transcript quantification

    • Blue Native PAGE to assess Complex I assembly

    • Polarographic measurement of NADH:ubiquinone activity

When developing these techniques for sunflower, researchers should consider the genetic diversity present in Helianthus populations. Studies on interspecific hybrids between H. annuus and H. tuberosus have demonstrated successful genetic manipulation and trait selection , providing valuable insights for developing CRISPR-based approaches tailored to sunflower genetics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.