Recombinant Helianthus annuus NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Helianthus annuus NAD(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic (ndhA)

Recombinant Helianthus annuus NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA) is a genetically engineered protein derived from the common sunflower (Helianthus annuus). This enzyme is a critical subunit of the chloroplast NAD(P)H dehydrogenase-like (NDH) complex, which facilitates photosystem I (PSI) cyclic electron transport and chlororespiration . Produced in E. coli expression systems, the recombinant form retains functional properties of the native protein and is widely used in biochemical research to study chloroplast metabolism and stress responses .

Functional Roles in Chloroplasts

The ndhA subunit is integral to the NDH complex, which performs two primary roles:

  1. Cyclic Electron Transport (CET): Facilitates electron recycling around PSI, balancing ATP/NADPH production during photosynthesis .

  2. Chlororespiration: Mediates plastoquinone reduction, linking photosynthetic and respiratory pathways .

Key functional insights:

  • RNA Stability & Splicing: ndhA transcript stability is regulated by pentatricopeptide repeat (PPR) proteins (e.g., SOT1) and CRS2-associated factors (CAFs), which inhibit RNA degradation and enhance splicing efficiency .

  • Stress Adaptation: The NDH complex, including ndhA, is critical for plant resilience under high light, drought, and temperature extremes .

Experimental Applications

Recombinant ndhA is utilized in:

  • ELISA and Protein Interaction Studies: Used to investigate binding partners like CAF1/2 and SOT1 .

  • Structural Biology: Crystallography and mutagenesis to map substrate-binding sites (e.g., quinone interaction residues) .

  • Biotechnological Engineering: Artificial relocation of ndhA into chloroplasts enhances stress tolerance in engineered plants .

Key Research Findings

Recent studies highlight:

Study FocusKey DiscoveryCitation
RNA MetabolismCAF proteins stabilize ndhA transcripts by enhancing SOT1 binding and inhibiting RNA cleavage .
Protein RelocalizationndhA can be artificially targeted to chloroplasts, enabling metabolic engineering .
Complex AssemblyndhA interacts with PSI to form NDH-PSI supercomplexes, optimizing electron transport efficiency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
ndhA
Target Protein Sequence
MIIDTTEVQAINSFSRLESLKEVYGIIWVLIPIFTPVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVISILLSYLVIPFGY RLVLADLSIGVFLWIAISSIAPVGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFLVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIPVPELFDITKRGRV FGTIIGIFITLAKTYLFLFIPIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSSQL LSL
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinones within the photosynthetic electron transport chain, potentially also contributing to chloroplast respiration. This process involves FMN and iron-sulfur (Fe-S) centers as intermediate electron carriers. In this species, plastoquinone is believed to be the primary electron acceptor. NDH couples this redox reaction to proton translocation, generating a proton gradient that conserves energy.

Database Links

KEGG: han:4055622

Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.