Recombinant Helianthus annuus NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSLIPILVFFISGFLAPSSKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFVEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. In this species, the immediate electron acceptor is believed to be plastoquinone. The enzyme couples the redox reaction to proton translocation, conserving redox energy in a proton gradient.

Database Links

KEGG: han:4055703

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the structure of ndhC contribute to its function in photosynthetic organisms?

The ndhC protein contains multiple hydrophobic regions that facilitate its integration into the thylakoid membrane. Analysis of the amino acid sequence reveals regions like "WAFLIISSLIPILVFFISGF" that likely form α-helical transmembrane domains. These structural features allow ndhC to participate in electron transport across the membrane, which is essential for its function in the NDH complex .

The protein contains conserved regions that interact with other NDH subunits to form a functional complex. The expression region (amino acids 1-120) is particularly important for proper folding and interaction with other components of the electron transport chain .

What is known about ndhC conservation across plant species compared to Helianthus annuus?

While the search results don't provide direct comparative data, the ndhC gene is generally highly conserved across photosynthetic organisms due to its essential role in electron transport. In sunflower (Helianthus annuus), which is native to the Plains states and Mexico, this protein would be adapted to function under various environmental conditions common to these regions .

The conservation of ndhC can be evaluated through phylogenetic analysis, which often reveals higher conservation of functional domains compared to non-functional regions. Researchers studying ndhC should consider examining sequence homology across different Asteraceae family members to identify conserved motifs that might be critical for function.

What are the optimal conditions for storing and handling recombinant Helianthus annuus ndhC protein?

According to product specifications, recombinant Helianthus annuus ndhC should be stored at -20°C, while extended storage should be at -20°C or -80°C. The protein is provided in a Tris-based buffer with 50% glycerol, optimized for stability. Working aliquots can be stored at 4°C for up to one week .

Important handling guidelines include:

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation

  • Prepare small working aliquots to minimize exposure to adverse conditions

  • When thawing, allow the protein to equilibrate to room temperature gradually before use

  • Handle the protein in appropriate buffers that maintain its native conformation

What expression systems are most effective for producing recombinant Helianthus annuus ndhC?

While specific expression systems for Helianthus annuus ndhC are not detailed in the search results, membrane proteins like ndhC typically require specialized expression systems. For chloroplastic membrane proteins, researchers should consider:

  • Bacterial expression systems: E. coli strains optimized for membrane protein expression (C41, C43)

  • Yeast systems: Pichia pastoris for eukaryotic post-translational processing

  • Insect cell expression systems: Baculovirus-infected insect cells for complex membrane proteins

The expression strategy should include optimization of:

  • Codon usage for the host organism

  • Induction conditions (temperature, inducer concentration)

  • Membrane solubilization methods using appropriate detergents

  • Purification tags that minimally affect protein function

How can researchers validate the functional activity of recombinant ndhC protein?

To validate functional activity, researchers should implement a multi-tiered approach:

  • Spectrophotometric assays: Measure NAD(P)H oxidation at 340 nm in the presence of appropriate quinone acceptors

  • Oxygen consumption measurements: Using Clark-type electrodes to monitor electron transport activity

  • Reconstitution studies: Incorporate purified ndhC into liposomes and measure electron transport

  • In vivo complementation: Express recombinant ndhC in mutant plants lacking functional ndhC and assess recovery of photosynthetic parameters

Activity assays should include positive controls (native protein preparations) and negative controls (heat-inactivated samples) to establish baseline measurements and confirm specificity.

How can researchers investigate the role of ndhC in drought tolerance in Helianthus annuus?

The search results indicate that Helianthus annuus has been studied under different water regimes, suggesting potential adaptation mechanisms to water stress . To investigate ndhC's role in drought tolerance, researchers could:

  • Compare ndhC expression levels between well-irrigated and partially irrigated conditions using quantitative PCR

  • Analyze ndhC protein abundance and post-translational modifications under water stress using proteomics approaches

  • Measure NDH complex activity in thylakoid membranes isolated from plants grown under different irrigation regimes

  • Create transgenic sunflower lines with altered ndhC expression and evaluate their performance under drought conditions

This approach would build upon existing QTL research in sunflower RILs under different water regimes, as described in the literature .

What methods are appropriate for studying protein-protein interactions involving ndhC in the NDH complex?

To elucidate the interactions of ndhC with other components of the NDH complex, researchers should consider:

  • Co-immunoprecipitation studies with antibodies against ndhC or known interacting partners

  • Yeast two-hybrid assays with membrane-optimized systems for transmembrane proteins

  • Bimolecular fluorescence complementation in plant protoplasts to visualize interactions in a near-native environment

  • Cross-linking studies followed by mass spectrometry to identify interaction sites

  • Blue native gel electrophoresis to analyze intact complexes

Data from these complementary approaches should be integrated to develop a comprehensive model of ndhC's position and interactions within the NDH complex architecture.

How does ndhC expression and function correlate with sunflower agricultural traits?

While direct correlations between ndhC and agricultural traits are not established in the search results, the QTL analysis of sunflower recombinant inbred lines provides a framework for investigating such relationships . Researchers could:

  • Examine co-localization of ndhC gene polymorphisms with QTLs associated with drought tolerance or photosynthetic efficiency

  • Compare ndhC sequence variations across sunflower varieties with different agronomic performances

  • Analyze the correlation between ndhC expression levels and traits such as:

    • Days from sowing to flowering

    • Plant height

    • Yield components

    • Leaf area at flowering

    • Leaf area duration

Table 1: Potential experimental design for investigating ndhC correlation with agricultural traits

ParameterWell-irrigated conditionPartially irrigated conditionMeasurement technique
ndhC expressionqRT-PCR quantificationqRT-PCR quantificationRelative expression normalized to reference genes
NDH complex activitySpectrophotometric assaySpectrophotometric assayRate of NAD(P)H oxidation (μmol/min/mg protein)
Days to floweringField observationField observationDays from sowing to anthesis
YieldGrain yield per plantGrain yield per plantWeight in grams
Leaf parametersLeaf area at floweringLeaf area at floweringcm² measured by imaging software

What are common challenges in expressing and purifying functional ndhC protein?

Researchers working with membrane proteins like ndhC typically encounter several challenges:

  • Protein misfolding and aggregation due to hydrophobic transmembrane domains

  • Low expression yields compared to soluble proteins

  • Difficulty maintaining native conformation during solubilization and purification

  • Potential toxicity to expression host cells

To address these challenges:

  • Use specialized expression strains designed for membrane proteins

  • Optimize detergent selection for solubilization (test multiple classes of detergents)

  • Consider fusion partners that enhance solubility without disrupting function

  • Implement gentle purification protocols that maintain the native lipid environment when possible

How can researchers reconcile contradictory data regarding ndhC function in different experimental contexts?

When faced with conflicting results regarding ndhC function, researchers should systematically:

  • Evaluate experimental differences:

    • Growth conditions (light intensity, temperature, water availability)

    • Developmental stage of sampled tissues

    • Genetic background variations

  • Implement standardized protocols:

    • Define precise growth conditions

    • Establish uniform sampling procedures

    • Use consistent protein extraction and analysis methods

  • Perform meta-analysis:

    • Compile data from multiple studies

    • Identify variables that might explain discrepancies

    • Weight results based on methodological rigor

  • Consider biological context:

    • NDH complex function may vary depending on environmental stressors

    • Alternative electron transport pathways may compensate for ndhC dysfunction under specific conditions

What statistical approaches are most appropriate for analyzing changes in ndhC expression across different experimental conditions?

Based on QTL research methods described in the literature , appropriate statistical approaches include:

  • Analysis of variance (ANOVA) to determine significant differences between treatments and genotypes

  • Multiple comparison tests (Tukey's HSD) to identify specific significant differences between groups

  • Mixed linear models incorporating both fixed effects (treatments) and random effects (genetic background)

  • Principal component analysis to identify patterns in multivariate datasets

  • Correlation and regression analyses to identify relationships between ndhC expression and physiological parameters

When analyzing QTL data related to ndhC expression, researchers should consider:

  • Phenotypic variance explained by QTLs (R²)

  • Additive effects of multiple QTLs

  • Epistatic interactions between QTLs

  • Environmental interactions with genetic factors

How might CRISPR/Cas9 technology be applied to study ndhC function in Helianthus annuus?

CRISPR/Cas9 genome editing offers powerful approaches for studying ndhC function:

  • Generate knockout lines to assess the impact of ndhC loss on photosynthesis and stress responses

  • Create point mutations to study specific amino acid residues critical for function

  • Introduce fluorescent protein tags to visualize ndhC localization and dynamics

  • Modify regulatory regions to alter expression patterns and levels

When designing CRISPR experiments for chloroplast-encoded genes like ndhC, researchers must consider organelle-specific transformation strategies or target nuclear factors that regulate chloroplast gene expression.

What emerging technologies could enhance our understanding of ndhC's role in photosynthetic efficiency?

Several cutting-edge technologies could advance ndhC research:

  • Cryo-electron microscopy for high-resolution structural studies of the intact NDH complex

  • Single-molecule tracking to observe ndhC dynamics in thylakoid membranes

  • Advanced spectroscopic techniques (e.g., 2D electronic spectroscopy) to study electron transfer kinetics

  • Multi-omics integration of transcriptomics, proteomics, and metabolomics data

  • Systems biology approaches to model ndhC function within the broader context of photosynthetic regulation

How might ndhC function contribute to sunflower adaptation to climate change?

Given Helianthus annuus adaptability to various environments , investigating ndhC's role in climate resilience is valuable:

  • Examine ndhC sequence variations in sunflower populations from diverse climatic regions

  • Test ndhC activity under projected climate change conditions (elevated CO₂, temperature, drought)

  • Assess how ndhC contributes to non-photochemical quenching mechanisms that prevent photodamage under stress

  • Investigate the relationship between ndhC function and water-use efficiency in sunflower

This research would build on existing studies of sunflower performance under different water regimes and could identify genetic resources for breeding climate-resilient varieties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.