Recombinant Helianthus annuus NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Characterization

Recombinant ndhG from other plant species (e.g., Morus indica) provides a template for sunflower applications:

ParameterDetails
Expression SystemEscherichia coli with N-terminal His-tag fusion .
Protein Length176–189 amino acids, depending on species .
PurificationAffinity chromatography via His-tag, followed by gel filtration .

While Helianthus annuus ndhG has not been explicitly expressed, its homologs retain conserved domains (e.g., NAD(P)H-binding motifs and transmembrane helices), suggesting similar recombinant strategies would apply .

Research Findings on Chloroplast NDH

Key discoveries about the NDH complex, relevant to ndhG’s role:

  • Interaction with PSI: NDH forms a supercomplex with PSI in sunflower and Arabidopsis, enhancing stability under high light . This interaction requires accessory proteins like Lhca5/Lhca6 .

  • Assembly Factors: Stromal chaperones (e.g., CRR41, CRR42) and metalloproteins (e.g., HCF101) mediate [4Fe-4S] cluster insertion and subunit folding .

  • Electron Transfer Mechanism: NDH accepts electrons from ferredoxin (Fd) rather than directly from NAD(P)H, a distinction from bacterial counterparts .

Functional Implications in Sunflower

In Helianthus annuus, ndhG likely contributes to:

  • Cyclic Electron Flow: Recycling electrons from PSI to maintain ATP synthesis during stress .

  • Chlororespiration: Reducing plastoquinone in darkness to regulate stromal redox state .

Mutants lacking functional NDH subunits exhibit impaired post-illumination chlorophyll fluorescence recovery, underscoring their role in redox homeostasis .

Future Directions

Further studies should address:

  • Crystal structures of sunflower ndhG to clarify substrate-binding dynamics.

  • Engineering redox properties for stress tolerance in crops.

  • Elucidating species-specific differences in NDH-PSI supercomplex assembly .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes section, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. We encourage you to contact your local distributor for precise delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial before opening to ensure the contents are collected at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoted storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by a variety of factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us and we will prioritize developing it for your order.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
ndhG
Target Protein Sequence
MDLPGLIHDFLLVFLGLGLILGGLGVVLLANPIYSAFSLGLVFVCISLFYILSNSHFVAA AQLLIYVGAINVLIIFAVMFINGSEYSKDFHLWTVGDGVTSVVCTSLFVSLITTIPDTSW YGIIWTTKANQIIEQDLISNSQQIGIHLSTDFFIPFEFISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain, potentially including a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. NDH couples the redox reaction to proton translocation, thus conserving redox energy within a proton gradient.
Database Links

KEGG: han:4055624

Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of the NDH complex in Helianthus annuus chloroplasts and where does ndhG fit in?

The chloroplast NDH complex can be divided into four subcomplexes: membrane, lumen, and stroma-exposed A and B subcomplexes. The membrane subcomplex contains seven plastid-encoded subunits, NdhA–NdhG. Subcomplex A contains four plastid-encoded subunits (NdhH–NdhK) and four nucleus-encoded subunits (NdhL–NdhO). The B and lumen subcomplexes contain subunits that are specific to higher plants .

The assembly of these subcomplexes occurs in a stepwise manner and requires coordination between plastid and nucleus-encoded products. NdhG, as part of the membrane subcomplex, plays a structural role in anchoring the complex within the thylakoid membrane. Each subcomplex assembles independently before combining to form the complete NDH complex that ultimately interacts with photosystem I (PSI) to form the NDH-PSI supercomplex .

How does ndhG contribute to the function of the NDH complex in sunflower chloroplasts?

NdhG serves as an integral membrane subunit of the NDH complex, facilitating electron transport during cyclic electron flow around photosystem I. This process is crucial for balancing the ATP/NADPH ratio during photosynthesis, particularly under variable light conditions or environmental stress.

The NDH complex accepts electrons from ferredoxin (Fd) through the peripheral subunit NdhS (CHLORORESPIRATORY REDUCTION31 [CRR31]) rather than directly from NAD(P)H, as previously thought . This electron transfer mechanism helps maintain redox balance in chloroplasts and contributes to photoprotection under high light conditions. NdhG, along with other membrane subunits, provides the structural foundation necessary for this electron transport chain to function properly.

What genomic variations exist in ndhG between domesticated and wild Helianthus annuus?

Comparative genomic analyses of chloroplast genomes between domesticated and wild sunflower have revealed several polymorphic sites, including SNPs and SSRs (Simple Sequence Repeats). Chloroplast genome comparisons identified 22 SNPs between domesticated and wild sunflower, with transitions (59.1%) being more common than transversions (40.9%) .

Although the search results don't explicitly mention ndhG-specific variations, the genomic patterns observed in chloroplast genes suggest that similar variations might exist in ndhG. These variations could include synonymous and non-synonymous substitutions that might affect protein structure or function. Of the 22 SNPs identified in the chloroplast genome, 7 SNPs in coding regions were synonymous while only 2 were non-synonymous , suggesting strong selective pressure to maintain protein function.

What are the most effective protocols for measuring NAD(P)H:quinone oxidoreductase activity in recombinant Helianthus annuus ndhG?

The measurement of NAD(P)H:quinone oxidoreductase activity in recombinant proteins can be conducted using a spectrophotometric assay that monitors the oxidation of NADH to NAD+ at 340 nm. This approach follows the conserved ping-pong mechanism of flavodoxin-like proteins, where NADH oxidation (measured as a decrease in absorbance at 340 nm) serves as an indicator of quinone conversion to quinol/hydroquinone .

Protocol overview:

  • Prepare cell lysates from either bacterial expression systems containing recombinant ndhG or from sunflower tissues expressing native or modified ndhG.

  • Quantify protein concentration using Bradford or BCA assay.

  • Prepare reaction mixture containing buffer, NADH (or NADPH), and quinone substrate.

  • Add protein extract to initiate the reaction.

  • Monitor the decrease in absorbance at 340 nm over time using a spectrophotometer.

  • Calculate enzyme activity using the extinction coefficient of NADH (6220 M⁻¹cm⁻¹).

This protocol can be adapted to test different quinone substrates, such as menadione, to evaluate substrate specificity of the enzyme . Additionally, comparisons between wild-type and modified ndhG can be performed to assess the functional impact of specific amino acid residues.

How can researchers optimize the heterologous expression of recombinant Helianthus annuus ndhG in bacterial systems?

Optimizing heterologous expression of chloroplast membrane proteins like ndhG presents several challenges, including proper folding, solubility, and potential toxicity to the host. Based on research practices for similar proteins, the following strategies can enhance recombinant ndhG expression:

  • Codon optimization: Adapt the coding sequence to match the codon bias of the expression host (e.g., E. coli) to improve translation efficiency.

  • Expression vectors and tags: Employ vectors with inducible promoters (e.g., T7) and fusion tags (e.g., His6, GST, or MBP) that can enhance solubility and facilitate purification.

  • Host strains: Use specialized E. coli strains such as C41(DE3) or C43(DE3) designed for membrane protein expression, or strains containing additional chaperones (e.g., GroEL/GroES) to assist in protein folding.

  • Expression conditions:

    • Induce at lower temperatures (16-20°C)

    • Use lower inducer concentrations

    • Employ minimal media or defined media with specific additives

    • Optimize cell density at induction (typically OD600 = 0.6-0.8)

  • Membrane extraction: Utilize mild detergents (DDM, LDAO) for solubilization of the membrane fraction containing the recombinant protein.

This approach requires careful optimization of each parameter to achieve functional expression of ndhG, which can then be verified using activity assays such as the NAD(P)H:quinone oxidoreductase assay described above .

What strategies exist for generating transgenic sunflower lines with modified ndhG for functional studies?

Generating transgenic sunflower lines with modified ndhG involves several specialized techniques due to the location of ndhG in the chloroplast genome. The following approaches can be considered:

  • Chloroplast transformation: The most direct approach involves biolistic delivery of a vector containing the modified ndhG gene flanked by chloroplast homologous sequences to facilitate integration via homologous recombination. Selection markers such as antibiotic resistance genes (aadA) can be used to identify transformants.

  • CRISPR/Cas9-based editing: While direct editing of the chloroplast genome using CRISPR/Cas9 is challenging, advances in chloroplast-targeted CRISPR systems offer potential approaches. This may involve expressing Cas9 with a chloroplast transit peptide and plastid-specific sgRNAs.

  • Complementation in ndhG-deficient lines: Natural or induced mutants with ndhG deficiencies can be complemented with variant forms of ndhG to study specific functional aspects.

  • Haploid induction methods: Recent advances in sunflower haploid induction, such as CENTROMERIC HISTONE3 (CenH3) modification approaches, can be utilized to speed up the generation of homozygous lines following transformation . This approach has shown success in other crops with modification frequencies ranging from 0.61% to 12.2% .

Each approach requires careful design of the genetic construct, including appropriate regulatory elements (promoters, terminators) and selection strategies to ensure stable expression of the modified ndhG in the chloroplast environment.

How should researchers design comparative experiments to assess functional differences between wild-type and modified ndhG variants?

When designing comparative experiments to assess functional differences between wild-type and modified ndhG variants, researchers should implement a comprehensive approach that addresses multiple levels of analysis:

  • Experimental design foundation:

    • Include appropriate biological replicates (minimum n=3)

    • Incorporate technical replicates for each assay

    • Use appropriate statistical tests for data analysis (ANOVA, t-tests)

    • Include relevant controls (empty vector, inactive mutants)

  • Multi-level analysis framework:

    Analysis LevelTechniquesParameters Measured
    Gene expressionqRT-PCR, RNA-SeqTranscript abundance, splicing patterns
    Protein analysisWestern blotting, mass spectrometryProtein accumulation, post-translational modifications
    Complex assemblyBlue-native PAGE, co-immunoprecipitationIntegration into NDH complex, interaction with other subunits
    Enzymatic activitySpectrophotometric assaysNAD(P)H oxidation rates with various substrates
    Photosynthetic performanceChlorophyll fluorescence, P700 absorbanceCyclic electron flow, PSI re-reduction kinetics
    Stress responsesGrowth analyses under various conditionsTolerance to high light, temperature extremes, drought
  • Environmental variables: Test plants under multiple conditions to reveal condition-dependent phenotypes:

    • Standard growth conditions

    • High light stress

    • Temperature extremes

    • Drought conditions

    • Fluctuating light regimes

  • Developmental timeline: Assess phenotypes at different developmental stages to capture age-dependent effects.

This multi-faceted approach allows for a comprehensive understanding of how specific modifications to ndhG affect its function within the NDH complex and the broader implications for plant physiology .

What protocols exist for isolating intact NDH complexes containing ndhG from Helianthus annuus chloroplasts?

Isolation of intact NDH complexes containing ndhG from Helianthus annuus chloroplasts requires careful handling to preserve the complex integrity. The following protocol synthesizes approaches used for similar complexes:

Protocol for NDH complex isolation:

  • Chloroplast isolation:

    • Harvest young sunflower leaves (10-15 g)

    • Homogenize in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.8, 2 mM EDTA, 1 mM MgCl₂, 5 mM ascorbate)

    • Filter through 4 layers of cheesecloth and 1 layer of Miracloth

    • Centrifuge at 1,000 × g for 5 min at 4°C

    • Resuspend pellet in isolation buffer

    • Purify chloroplasts via Percoll gradient centrifugation

  • Thylakoid membrane isolation:

    • Lyse chloroplasts in hypotonic buffer (10 mM HEPES-KOH pH 7.8, 5 mM MgCl₂)

    • Centrifuge at 10,000 × g for 10 min at 4°C

    • Wash thylakoid pellet with storage buffer (100 mM sorbitol, 10 mM HEPES-KOH pH 7.8, 10 mM MgCl₂)

  • Membrane solubilization:

    • Adjust chlorophyll concentration to 1 mg/ml

    • Add n-dodecyl-β-D-maltoside (DDM) to 1% final concentration

    • Incubate on ice for 10 min with gentle agitation

    • Centrifuge at 20,000 × g for 10 min at 4°C to remove insoluble material

  • NDH complex purification:

    • Subject solubilized thylakoids to sucrose gradient ultracentrifugation or

    • Perform blue-native PAGE for analysis or

    • Use immunoprecipitation with antibodies against NDH subunits

  • Complex verification:

    • Western blot analysis using antibodies against multiple NDH subunits

    • In-gel activity assays using NAD(P)H and artificial electron acceptors

    • Mass spectrometry to confirm subunit composition

This protocol can be adapted to compare NDH complex composition and integrity between wild-type and plants with modified ndhG, providing insights into the role of ndhG in complex assembly and stability .

How can researchers use chlorophyll fluorescence to assess the functional impact of ndhG modifications on NDH activity in vivo?

Chlorophyll fluorescence provides a non-invasive method to assess NDH activity in vivo, making it valuable for evaluating the functional impact of ndhG modifications. The following methodology enables quantitative assessment of NDH function:

  • Transient increase in chlorophyll fluorescence after illumination (TIOF):

    • Dark-adapt plants for 30 minutes

    • Apply saturating light (e.g., 120 μmol photons m⁻² s⁻¹) for 5 minutes

    • Turn off actinic light and record chlorophyll fluorescence

    • Quantify the transient increase in fluorescence that occurs after illumination

    • This increase represents post-illumination NDH activity

  • PSI oxidation-reduction kinetics:

    • Measure P700 absorbance changes at 830 nm

    • Apply far-red light to oxidize P700

    • Monitor re-reduction kinetics after turning off the light

    • Calculate the rate constant for the NDH-dependent phase of P700 re-reduction

  • Electron flow measurements under fluctuating light:

    • Subject plants to alternating high and low light intensities

    • Monitor photosynthetic parameters including:

      • Quantum yield of PSI and PSII (Y(I) and Y(II))

      • Non-photochemical quenching (NPQ)

      • Electron transport rate (ETR)

    • Compare response dynamics between wild-type and modified plants

  • Data analysis and quantification:

    ParameterCalculationBiological Significance
    TIOF amplitudeFafter - FbeforeCorrelates with NDH activity
    NDH-dependent P700 re-reductionExponential decay constantMeasures cyclic electron flow rate
    ETR(I)/ETR(II) ratioY(I) × PAR / Y(II) × PARIndicates cyclic vs. linear electron flow balance
    NPQ induction rateΔNPQΔt⁻¹Reflects photoprotective capacity
  • Integrated phenotyping:

    • Compare growth rates under fluctuating light conditions

    • Assess stress tolerance (high light, temperature extremes)

    • Measure photosynthetic efficiency under different CO₂ concentrations

These methods allow researchers to quantitatively assess how modifications to ndhG affect NDH function in the context of the living plant, providing insights into both biochemical function and physiological relevance .

How can researchers develop diagnostic SNP markers for ndhG to facilitate marker-assisted selection in sunflower breeding programs?

Developing diagnostic SNP markers for ndhG requires a systematic approach to identify polymorphisms and validate their association with traits of interest:

  • SNP discovery phase:

    • Perform targeted sequencing of ndhG from diverse sunflower germplasm, including wild relatives, landraces, and elite cultivars

    • Align sequences to identify polymorphic sites

    • Focus on SNPs in coding regions that might affect protein function

    • Utilize existing genomic resources, such as the XRQr1.0 genome assembly, to place markers in genomic context

  • Marker development strategy:

    • Design PCR primers flanking identified SNPs

    • Develop high-throughput genotyping assays using:

      • KASP (Kompetitive Allele Specific PCR)

      • TaqMan assays

      • Tetra-primer ARMS-PCR

  • Validation process:

    • Test markers on a panel of diverse germplasm to confirm polymorphism

    • Evaluate markers in segregating populations to confirm Mendelian inheritance

    • Assess marker-trait associations in biparental populations or association panels

  • Implementation in breeding programs:

    • Develop multiplexed assays to simultaneously genotype multiple SNPs

    • Integrate markers into existing breeding pipelines

    • Use markers for rapid screening of breeding material

  • Technical specifications for robust marker design:

    Marker Design ParameterRecommended Range
    PCR amplicon size80-200 bp
    GC content of primers40-60%
    Tm of primers58-62°C
    Primer length18-25 nucleotides
    Distance of SNP from primer end≥ 3 nucleotides

The development of diagnostic SNP markers for ndhG will facilitate marker-assisted selection in sunflower breeding programs, allowing for more efficient selection of variants associated with enhanced photosynthetic efficiency, stress tolerance, or other desired traits .

What methodologies exist for mapping genetic loci associated with ndhG variation and its phenotypic effects in sunflower populations?

Mapping genetic loci associated with ndhG variation involves several complementary approaches:

  • Biparental mapping populations:

    • Develop F₂, backcross, or recombinant inbred line (RIL) populations

    • Genotype using SNP arrays, genotyping-by-sequencing (GBS), or specific marker panels

    • Phenotype for traits related to photosynthetic efficiency, stress tolerance, etc.

    • Perform QTL analysis to identify genomic regions associated with phenotypic variation

    • Use high-resolution mapping with large populations to fine-map the target region

  • Association mapping/GWAS:

    • Utilize diverse germplasm collections or breeding panels

    • Perform dense genotyping using SNP arrays or sequencing approaches

    • Collect comprehensive phenotypic data

    • Apply statistical models accounting for population structure and kinship

    • Identify significant marker-trait associations

  • Bulk segregant analysis (BSA):

    • Create pools of individuals with extreme phenotypes

    • Perform whole-genome sequencing of the pools

    • Identify regions with allele frequency differences between pools

    • Focus on the chloroplast genome region containing ndhG

  • Fine mapping strategies:

    • Develop a large segregating population (≥2000 individuals)

    • Identify recombinants in the target region using flanking markers

    • Develop additional markers in the region of interest

    • Test recombinant families for phenotypic effects

    • Narrow down the genetic interval containing the causal variation

  • Integration with genomic resources:

    • Align identified regions with reference genome assemblies

    • Compare with previously mapped resistance gene clusters or other functional loci

    • Use genomic prediction models to estimate breeding values based on marker data

These methodologies allow researchers to precisely map genetic loci associated with ndhG variation and understand their phenotypic effects in sunflower populations, facilitating genetic improvement through marker-assisted selection or genomic selection approaches .

How can researchers utilize doubled haploid technology to accelerate genetic studies of ndhG in sunflower?

Doubled haploid (DH) technology offers significant advantages for accelerating genetic studies of ndhG in sunflower:

  • Advantages of doubled haploids for ndhG studies:

    • Rapid generation of homozygous lines

    • Simplified genetic analysis due to absence of dominance effects

    • Increased efficiency in identifying recessive traits

    • Accelerated development of mapping populations

    • Facilitated study of plastid-nuclear interactions

  • CENTROMERIC HISTONE3 (CenH3) modification approach:

    • Single-step method based on targeting endogenous CenH3 gene

    • Can involve CenH3 gene silencing using RNAi, induced point mutations, or CRISPR/Cas9 gene knockouts

    • Random point mutations in five specific amino acids (P82S, G83E, A132T, A136T, and A86V) have produced paternal haploids at rates of 0.61% to 12.2%

    • Complete deletions of the α-N helix of the HFD region can result in haploids upon crossing with wild type plants

  • Application workflow:

    • Create haploid inducer lines using CenH3 modification

    • Cross inducer lines with elite material carrying ndhG variants of interest

    • Identify haploid progeny via morphological markers or flow cytometry

    • Double chromosomes using colchicine or alternative doubling agents

    • Confirm doubled haploids via molecular markers or flow cytometry

    • Evaluate resulting DH lines for ndhG-related traits

  • Integration with other breeding technologies:

    • Combine with marker-assisted selection for rapid introgression of ndhG variants

    • Use DH lines for transformation experiments targeting ndhG modification

    • Develop DH mapping populations for high-resolution mapping of ndhG-related traits

    • Accelerate pyramiding of multiple beneficial alleles

  • Potential challenges and solutions:

    ChallengeSolution
    Low haploid induction ratesOptimize CenH3 modification strategy; screen multiple inducer candidates
    Genotype-dependent responseTest induction efficiency across diverse germplasm
    Chromosome doubling efficiencyOptimize doubling protocols; test alternative doubling agents
    Albinism in some haploidsSelect green sectors for chromosome doubling; use optimized tissue culture protocols

Doubled haploid technology significantly accelerates genetic studies of ndhG in sunflower by providing homozygous lines in a single generation, facilitating precise genetic analysis and accelerating breeding programs focused on photosynthetic efficiency .

How does the electron transport mechanism of recombinant Helianthus annuus ndhG differ from that of other species, and what experimental approaches can elucidate these differences?

The electron transport mechanism involving ndhG in Helianthus annuus may exhibit unique characteristics compared to other species, reflecting evolutionary adaptations to specific ecological niches. To elucidate these differences:

  • Comparative biochemical analysis:

    • Express recombinant ndhG from different species (sunflower, Arabidopsis, rice, etc.)

    • Perform enzyme kinetics studies measuring:

      • Substrate affinity (Km) for various quinones

      • Maximum reaction velocity (Vmax)

      • Inhibitor sensitivity profiles

    • Compare redox potentials and electron transfer rates

  • Structural biology approaches:

    • Determine protein structures using X-ray crystallography or cryo-EM

    • Focus on regions involved in cofactor binding, substrate interaction, and protein-protein interfaces

    • Perform in silico molecular dynamics simulations to analyze functional movements

    • Use site-directed mutagenesis to test hypotheses about structure-function relationships

  • Species-specific adaptations to investigate:

    • Temperature dependence of activity (reflecting adaptation to different thermal environments)

    • pH optima and response to ionic strength

    • Interaction with species-specific partner proteins

    • Post-translational modifications unique to sunflower

  • Integrated electron flow analysis:

    • Reconstitute partial or complete electron transport chains in vitro

    • Measure electron transfer rates using artificial electron donors/acceptors

    • Perform spectroscopic analyses (EPR, UV-vis) to track redox states of cofactors

    • Compare cyclic electron flow efficiency across species using chloroplast preparations

  • Experimental designs for comparative studies:

    ApproachTechniqueKey Parameters
    Protein-levelEnzyme kineticsKm, Vmax, kcat/Km, inhibition constants
    Complex-levelBlue-native PAGE with activity stainingComplex assembly, stability, activity
    Electron flowP700 reduction kineticsCyclic electron flow rates and capacity
    Plant physiologyGas exchange, chlorophyll fluorescencePhotosynthetic efficiency under various conditions

These approaches would reveal how the electron transport mechanism involving ndhG in sunflower has evolved compared to other species, providing insights into adaptive modifications for specific environmental conditions .

What methods can be used to study the assembly pathway of NDH complexes and the specific role of ndhG in this process?

Studying the assembly pathway of NDH complexes and the specific role of ndhG requires a multi-faceted approach:

  • Pulse-chase labeling and immunoprecipitation:

    • Label newly synthesized proteins with radioactive amino acids

    • Chase with non-radioactive amino acids for various time periods

    • Immunoprecipitate with antibodies against different NDH subunits

    • Analyze samples by SDS-PAGE and autoradiography

    • Track the temporal incorporation of ndhG into assembly intermediates

  • Analysis of assembly intermediates:

    • Use blue-native PAGE to separate native complexes

    • Identify assembly intermediates via immunoblotting or mass spectrometry

    • Compare wild-type plants with ndhG mutants or plants with modified ndhG

    • Look for accumulation of specific subcomplexes in mutant backgrounds

  • Protein-protein interaction analysis:

    • Perform yeast two-hybrid or split-ubiquitin assays to identify direct interaction partners

    • Use co-immunoprecipitation to confirm interactions in vivo

    • Apply chemical cross-linking followed by mass spectrometry to map interaction interfaces

    • Perform FRET or BiFC assays in plant systems to visualize interactions in situ

  • Time-resolved proteomics:

    • Isolate chloroplasts at different developmental stages

    • Perform quantitative proteomics to track changes in NDH subunit abundance

    • Compare assembly states between wild-type and plants with modified ndhG

    • Identify assembly factors that co-accumulate with specific intermediates

  • Genetic approaches:

    • Analyze epistatic relationships between assembly factors

    • Create conditional mutants (temperature-sensitive, inducible) to arrest assembly at specific steps

    • Use complementation studies with chimeric proteins to identify functional domains

The assembly of NDH subcomplex A involves several intermediate complexes with molecular masses of ~800, ~500, and ~400 kD in the chloroplast stroma . Research has shown that the accumulation of 500- and 400-kD assembly intermediates is impaired in mutants lacking certain assembly factors, suggesting a stepwise assembly process that could be affected by modifications to ndhG .

What is known about the post-translational modifications of ndhG and how do they affect its function in the NDH complex?

While specific information about post-translational modifications (PTMs) of ndhG in Helianthus annuus is limited in the provided search results, we can outline research approaches to investigate this important aspect of protein regulation:

  • Identification of potential PTMs:

    • Perform mass spectrometry analysis of purified ndhG to identify PTMs:

      • Phosphorylation of Ser/Thr/Tyr residues

      • Acetylation of Lys residues

      • Methylation of Lys/Arg residues

      • Redox modifications of Cys residues

    • Compare PTM profiles under different conditions (light/dark, stress/control)

    • Use targeted proteomics to quantify specific modifications

  • Functional characterization of PTMs:

    • Generate site-directed mutants mimicking or preventing specific PTMs:

      • Phosphomimetic mutations (Ser/Thr → Asp/Glu)

      • Phospho-null mutations (Ser/Thr → Ala)

      • Mutations affecting other PTMs (Lys → Arg to prevent acetylation)

    • Express mutant proteins and assess:

      • Integration into NDH complex

      • Enzymatic activity

      • Protein stability and turnover

      • Protein-protein interactions

  • Regulatory enzymes identification:

    • Identify kinases, phosphatases, acetyltransferases responsible for ndhG modifications

    • Use inhibitors, activators, or genetic approaches to manipulate these enzymes

    • Monitor effects on NDH assembly, stability, and function

  • Environmental and developmental regulation:

    • Analyze PTM patterns across different:

      • Developmental stages

      • Light conditions

      • Stress treatments

      • Nutrient availability

    • Correlate changes in PTMs with functional outcomes

  • Comparative analysis across species:

    • Compare PTM sites in ndhG across different plant species

    • Identify conserved modification sites suggesting functional importance

    • Analyze species-specific modifications that might reflect adaptations

Although specific data on ndhG PTMs is limited, research on other photosynthetic complexes suggests that PTMs likely play important roles in regulating assembly, activity, and turnover of NDH complexes in response to changing environmental conditions. Studies have shown that phosphorylation can regulate thylakoid protein complex assembly and stability, acetylation can influence enzyme activity, and redox modifications can act as environmental sensors .

What are the best statistical approaches for analyzing enzyme kinetic data from recombinant ndhG activity assays?

Analyzing enzyme kinetic data from recombinant ndhG activity assays requires appropriate statistical approaches to ensure reliable interpretation:

  • Michaelis-Menten kinetics analysis:

    • Fit reaction velocity vs. substrate concentration data to Michaelis-Menten equation:
      v=Vmax×[S]Km+[S]v = \frac{V_{max} \times [S]}{K_m + [S]}

    • Use non-linear regression rather than linearization methods (Lineweaver-Burk, Eadie-Hofstee)

    • Calculate 95% confidence intervals for Km and Vmax parameters

    • Test goodness of fit using residual analysis

  • Inhibition studies analysis:

    • Determine inhibition mechanism (competitive, non-competitive, uncompetitive, mixed)

    • Calculate inhibition constants (Ki) using appropriate models

    • Compare inhibition patterns across different substrates or conditions

  • Experimental design considerations:

    • Use technical replicates (n=3-6) for each substrate concentration

    • Include biological replicates (different protein preparations)

    • Control for potential confounding variables (temperature, pH, buffer composition)

    • Ensure adequate substrate concentration range (0.2Km to 5Km)

  • Advanced analytical approaches:

    • Employ global data fitting for complex kinetic mechanisms

    • Use model discrimination criteria (AIC, BIC) when comparing alternative models

    • Apply bootstrap methods to estimate parameter uncertainty

    • Consider Bayesian approaches for parameter estimation with prior knowledge

  • Statistical tests and visualizations:

    Analysis TypeStatistical ApproachVisualization
    Parameter comparisonANOVA with post-hoc testsForest plots with confidence intervals
    Substrate preferenceMultiple comparison testsRadar charts of efficiency constants (kcat/Km)
    Environmental effectsResponse surface methodology3D surface plots
    Kinetic mechanismModel comparison testsDiagnostic plots of different kinetic models

When analyzing NAD(P)H:quinone oxidoreductase activity, monitoring NADH oxidation at 340 nm provides a direct measure of enzyme activity . Statistical analysis should account for potential background NADH oxidation and ensure that measurements fall within the linear range of detection.

How can researchers reconcile contradictory results from different experimental approaches when studying ndhG function?

  • Systematic comparison framework:

    • Create a comprehensive matrix of experimental conditions and outcomes

    • Identify specific variables that differ between contradictory studies

    • Design targeted experiments to directly test critical variables

  • Sources of experimental variation to consider:

    • Protein preparation methods (expression system, purification protocol)

    • Assay conditions (temperature, pH, buffer composition, substrate quality)

    • Genetic background of plant material

    • Developmental stage and growth conditions

    • Measurement techniques and instruments

    • Data analysis methods and statistical approaches

  • Validation through complementary techniques:

    • Use orthogonal approaches to test the same hypothesis

    • Compare in vitro biochemical results with in vivo physiological measurements

    • Validate protein-level findings with genetic approaches

  • Meta-analysis approaches:

    • Perform quantitative synthesis of results across studies

    • Weight findings based on methodological quality

    • Identify moderator variables that explain heterogeneity

    • Calculate effect sizes to compare magnitude of results

  • Collaborative resolution strategies:

    • Organize round-robin experiments across laboratories

    • Develop standardized protocols and reference materials

    • Establish minimal information standards for reporting results

    • Create shared databases of raw data for re-analysis

When dealing with contradictions, consider that each approach may be revealing different aspects of ndhG function. For example, in vitro enzyme assays may not capture regulatory effects present in vivo, while genetic studies might be complicated by compensatory mechanisms. The research approach described for measuring NAD(P)H:quinone oxidoreductase activity in whole cell lysates demonstrates that results can differ between purified proteins and cellular contexts .

What bioinformatic tools and databases are most useful for analyzing sequence variations in ndhG across sunflower varieties and related species?

Analyzing sequence variations in ndhG across sunflower varieties and related species requires appropriate bioinformatic tools and databases:

  • Sequence databases and resources:

    • GenBank/EMBL/DDBJ for nucleotide and protein sequences

    • SunGene or Helianthus Genome Database for sunflower-specific resources

    • Chloroplast Genome Database for comparative chloroplast genomics

    • 1000 Plant Transcriptomes Project for broader comparative analysis

    • NCBI's Sequence Read Archive (SRA) for raw sequencing data

  • Sequence alignment and analysis tools:

    • MAFFT or T-Coffee for multiple sequence alignment

    • MEGA or PAUP for phylogenetic analysis

    • DnaSP for polymorphism analysis and neutrality tests

    • PAML for detecting selection signatures (dN/dS analysis)

    • PolyPhen-2 or SIFT for predicting functional impacts of amino acid substitutions

  • Structural bioinformatics tools:

    • I-TASSER or AlphaFold for protein structure prediction

    • PyMOL or UCSF Chimera for visualization and analysis of 3D structures

    • FoldX for calculating stability changes upon mutation

    • GROMACS for molecular dynamics simulations

    • ConSurf for mapping conservation onto protein structures

  • Population genetics and diversity analysis:

    • Structure for population structure analysis

    • Arlequin for genetic diversity metrics

    • TASSEL for genome-wide association analysis

    • Variant Effect Predictor for annotation of genetic variants

    • PopART for haplotype network visualization

  • Specific analyses for chloroplast genes:

    Analysis TypeToolsApplication to ndhG
    RNA editing site predictionPREP-Cp, PREPACTIdentify potential RNA editing sites in ndhG transcripts
    Chloroplast genome assemblyGetOrganelle, NOVOPlastyAssemble complete chloroplast genomes to analyze ndhG in genomic context
    Selective constraint analysisRELAX, MEMEDetect changes in selective pressure on ndhG across lineages
    Codon usage analysisCodonW, DAMBEAnalyze codon bias patterns in ndhG
    Recombination detectionRDP4, GARDIdentify potential recombination events affecting ndhG evolution

These bioinformatic resources can help researchers analyze the comparative genomics of ndhG across domesticated and wild sunflower varieties , as well as related species, providing insights into evolutionary patterns and functional constraints.

How might engineered variants of ndhG contribute to improving photosynthetic efficiency in crops facing climate change stressors?

Engineered variants of ndhG could potentially enhance photosynthetic efficiency in crops facing climate change stressors through several mechanisms:

  • Enhanced cyclic electron flow (CEF) for improved stress tolerance:

    • Modified ndhG variants with increased stability under high temperatures

    • Variants with altered regulatory properties to increase CEF under drought conditions

    • Engineered proteins with optimized kinetic properties to better balance ATP/NADPH ratios

  • Stress-specific adaptations:

    • Introduction of ndhG variants from extremophile plant species

    • Engineering redox-sensing capabilities to respond dynamically to oxidative stress

    • Modifications to alter interaction with regulatory proteins under stress conditions

  • Improved assembly and stability of NDH complex:

    • Engineering enhanced binding interfaces with other NDH subunits

    • Modifications to increase protein stability under fluctuating environmental conditions

    • Variants with reduced susceptibility to degradation under stress

  • Climate change-specific adaptations:

    • Variants optimized for function at elevated CO₂ concentrations

    • Modifications to enhance performance under increased temperature regimes

    • Engineered properties to maintain activity during heat waves or drought events

  • Predicted impacts of ndhG engineering on plant physiology:

    ModificationPhysiological ImpactClimate Resilience Benefit
    Enhanced thermal stabilityMaintained CEF during heat stressImproved photosynthesis during heat waves
    Increased electron transfer efficiencyImproved ATP productionEnhanced water-use efficiency during drought
    Altered regulatory phosphorylation sitesDynamic response to changing conditionsFaster recovery from stress events
    Optimized quinone binding siteMore efficient electron transferReduced photoinhibition under high light
    Enhanced protein-protein interactionsImproved NDH complex stabilityMaintained photosynthesis during multiple stresses

These engineered variants could be introduced into crops using chloroplast transformation techniques, potentially leading to improved resilience to climate change stressors while maintaining or enhancing photosynthetic efficiency .

What role might ndhG play in sunflower adaptation to different environmental conditions, and how can this be studied?

The role of ndhG in sunflower adaptation to different environmental conditions is a fascinating area for research:

  • Ecological adaptation patterns:

    • Compare ndhG sequences from sunflower ecotypes adapted to different environments:

      • Drought-prone vs. mesic habitats

      • High vs. low elevation populations

      • Northern vs. southern latitudinal clines

    • Look for correlations between sequence variants and environmental parameters

    • Test for signatures of selection in different populations

  • Physiological adaptation mechanisms:

    • Analyze cyclic electron flow capacity across ecotypes

    • Measure NDH complex activity under various stress conditions

    • Assess thermal tolerance of photosynthesis in relation to ndhG variants

    • Investigate photoprotection capacity in high-light adapted populations

  • Experimental approaches:

    • Perform reciprocal transplant experiments with genotyped populations

    • Use chloroplast transformation to swap ndhG variants between ecotypes

    • Conduct controlled environment studies manipulating multiple stressors

    • Employ high-throughput phenotyping to capture subtle physiological differences

  • Genomic approaches:

    • Perform genome-environment association studies

    • Analyze selective sweeps in the chloroplast genome

    • Study co-evolution between nuclear and chloroplast genes

    • Investigate within-species structural variation in the ndh gene complex

  • Comparative analysis framework:

    Environmental FactorExpected AdaptationExperimental Approach
    High temperatureEnhanced thermal stability of NDH complexCompare NDH activity across temperature gradients
    DroughtIncreased cyclic electron flow capacityMeasure CEF/LEF ratio under water limitation
    High lightEnhanced photoprotectionAnalyze NPQ induction and relaxation kinetics
    Cold climatesModified low-temperature activityMeasure electron transport at suboptimal temperatures
    Fluctuating environmentsRegulatory flexibilityTest response to variable vs. constant conditions

Comparative genomic analyses between domesticated and wild sunflower have already revealed polymorphisms in the chloroplast genome , suggesting that similar variations might exist in ndhG that could contribute to environmental adaptation.

What emerging technologies might advance our understanding of ndhG function in the next decade?

Several emerging technologies are poised to revolutionize our understanding of ndhG function in the next decade:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution structures of intact NDH complexes

    • Integrative structural biology combining multiple data sources (X-ray, NMR, crosslinking-MS)

    • Time-resolved structural methods to capture dynamic conformational changes

    • In-cell structural biology to study ndhG in its native environment

  • Single-molecule techniques:

    • Single-molecule FRET to monitor conformational dynamics

    • Optical tweezers to study mechanical properties and protein folding

    • Single-molecule tracking in chloroplast membranes

    • Patch-clamp of reconstituted NDH complexes to study ion translocation

  • Advanced genetic technologies:

    • Prime editing for precise modification of chloroplast genes

    • Inducible gene expression systems for chloroplasts

    • RNA-guided RNA targeting (CIRTS) for transcript manipulation

    • Synthetic biology approaches to design novel NDH complexes

  • Advanced imaging technologies:

    • Super-resolution microscopy of NDH complexes in thylakoid membranes

    • Label-free imaging using Raman microscopy or native fluorescence

    • Correlative light and electron microscopy for structural-functional studies

    • Expansion microscopy for enhanced spatial resolution in chloroplasts

  • Emerging technologies and their applications to ndhG research:

    TechnologyApplicationPotential Insight
    Spatial transcriptomicsMap gene expression in different leaf regionsLocal adaptation of ndhG expression to light environment
    Nanopore direct RNA sequencingIdentify RNA modifications in ndhG transcriptsPost-transcriptional regulation mechanisms
    Artificial intelligence protein designEngineer novel ndhG variantsEnhanced function or new capabilities
    Photosynthetic phenomicsHigh-throughput screening of photosynthetic parametersFunctional effects of ndhG variants across conditions
    Synthetic chloroplastsBottom-up assembly of minimal functional unitsEssential components for NDH function
  • Computational advances:

    • Quantum mechanics/molecular mechanics simulations of electron transfer

    • Machine learning for predicting protein-protein interactions

    • Network analysis of photosynthetic regulation

    • Whole-cell models incorporating chloroplast energetics

These emerging technologies will provide unprecedented insights into the structure, function, and regulation of ndhG and the NDH complex, potentially leading to breakthroughs in our understanding of photosynthetic electron transport and enabling novel approaches to crop improvement .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.