Recombinant Helianthus annuus Oleosin

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Oleosin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Protein Sequence
TTTTYDRHFTTTQPHYRQDDRSRYDQQTHSQSTSRTLAIIALLPVGGILLGLAALTFIGT LIGLALATPLFVIFSPIIVPAVLTIGLAVTGFLASGTFGLTGLSSLSYLFNMVRQTAGSV PESLDYVKGTLQDAGEYAGQKTKDFGQKIQSTAHEMGDQGQVGVHAQVGGGKEGRKSGDR T
Uniprot No.

Target Background

Function
Plays a structural role in stabilizing lipid bodies during seed desiccation by preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase binding during lipolysis in seedling growth.
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What is the structural composition of Helianthus annuus oleosin?

Helianthus annuus (sunflower) oleosin is a hydrophobic protein with a distinctive tripartite structure consisting of:

  • N-terminal hydrophilic domain

  • Central hydrophobic domain (68-74 residues)

  • C-terminal hydrophilic domain

The central hydrophobic domain forms an alpha-helical hairpin structure when in environments mimicking oil bodies, with the two helices separated by a turn region. This structure has been confirmed through circular dichroism spectroscopy in solvent systems such as trifluoroethanol and SDS that mimic the oil body environment . The hydrophobic domain forms a loop that penetrates into the triacylglycerol matrix of the oil body, while the hydrophilic domains remain on the surface of the oil body .

What expression systems are effective for producing recombinant Helianthus annuus oleosin?

Recombinant sunflower oleosin can be successfully expressed in multiple systems:

  • Prokaryotic expression (E. coli):

    • Oleosin accumulates in inclusion bodies

    • Often expressed as fusion proteins (e.g., with maltose-binding protein)

    • Requires solubilization and refolding protocols

    • Allows rapid testing of modified oleosins without plant transformation

  • In planta expression:

    • Targeted expression in seeds leads to incorporation into native oil bodies

    • Requires plant transformation and seed development cycle

    • Allows study of physiological effects on seed properties

  • Yeast expression:

    • Successfully targets oleosins to lipid bodies

    • Requires functional signal recognition particle (SRP) and SEC61 translocon

For purification of recombinant oleosin from E. coli, sequential digestion protocols have been developed, such as using factor Xa to remove fusion tags followed by proteolytic removal of terminal domains to isolate the hydrophobic domain for structural studies .

How do recombinant oleosins affect oil body properties?

Recombinant oleosins significantly influence oil body properties in several ways:

PropertyEffect of Recombinant OleosinMechanism
Structural integrityIncreasedPrevention of coalescence during cell dehydration
Emulsion stabilityEnhancedSurface-active properties at oil-water interface
Freezing toleranceImproved (especially with polyoleosins)Stabilization of membranes during freeze-thaw cycles
Size regulationControls oil body diameterOleosin:TAG ratio determines surface area/volume
Germination rateMay delay (especially with hexameric oleosin)Effect on oil mobilization kinetics

Interestingly, the presence of polyoleosins (multiple oleosin units joined in tandem) increases freezing tolerance of imbibed seeds and enhances the emulsion stability and structural integrity of purified oil bodies, with greater effects observed as the number of oleosin repeats increases .

What methodological approaches are most effective for creating and analyzing polyoleosins?

Polyoleosins (multiple oleosin units in tandem head-to-tail fusions) require specific methodological considerations:

Construction methodology:

  • Design gene constructs with specific linker sequences between oleosin repeats

  • Include flexible amino acid residues between repeats to allow sufficient movement

  • Incorporate convenient sub-cloning sites for insertion of other in-frame recombinant sequences

  • Express constructs in either E. coli or transgenic plants

Purification protocol:

  • For bacterial expression: Isolate inclusion bodies

  • Solubilize using appropriate detergents or chaotropic agents

  • Perform affinity chromatography if fusion tags are used

  • Verify purity through SDS-PAGE and Western blotting

Analytical methods:

  • Assess oil body/artificial oil body stability through freeze-thaw cycles

  • Measure emulsion stability using spectrophotometric techniques

  • Observe oil body integrity using microscopy techniques

  • Analyze thermal stability using differential scanning calorimetry

Up to six tandem repeats of oleosin have been successfully expressed both in plants and E. coli systems, with polyoleosins accumulating in native plant oil bodies and bacterial inclusion bodies . The polyoleosin approach offers significant advantages over single oleosin units, including enhanced thermal stability of emulsions and stronger anchoring of fused peptides to oil bodies .

How does the hydrophobic domain structure affect oleosin functionality and applications?

The hydrophobic domain structure of oleosin is critical to its functionality:

  • Structural insights: Circular dichroism spectroscopy demonstrates that the hydrophobic domain adopts predominantly alpha-helical structures in environments mimicking oil bodies . This alpha-helical hairpin structure, with the two helices separated by a turn region, allows the protein to penetrate into the oil body while maintaining stability.

  • Structure-function relationship: The hydrophobic domain's structure determines:

    • Depth of penetration into oil bodies

    • Stability of the protein at the oil-water interface

    • Ability to prevent oil body coalescence

    • Interactions with phospholipids in the oil body monolayer

  • Mutational approaches: Modifying specific residues within the hydrophobic domain can alter:

    • Hairpin stability

    • Oil body targeting efficiency

    • Self-assembly properties

  • Application considerations: When designing oleosin-based biotechnological applications, the integrity of the hydrophobic domain must be preserved to maintain functionality while modifications to the hydrophilic domains can be more extensive .

Experimental evidence indicates that the self-assembly properties of recombinant oleosin variants are not directly related to changes in secondary structure, as demonstrated by circular dichroism analysis . This suggests that higher-order interactions between oleosin molecules, rather than changes in individual protein folding, drive the formation of different nanostructures.

What factors influence the self-assembly of recombinant oleosin into different suprastructures?

Recombinant oleosin can self-assemble into various suprastructural morphologies depending on specific factors:

FactorEffect on Self-AssemblyResulting Structures
Solution ionic strengthAlters electrostatic interactionsAffects transition between morphologies
Protein hydrophilic fractionDetermines membrane thicknessHigher fraction correlates with thicker membranes
Hydrophobic domain lengthInfluences core structure stabilityFixed length needed for stable morphologies
pHAffects charge distributionInfluences assembly kinetics
TemperatureChanges protein-protein interactionsImpacts assembly rate and final structure

Cryo-TEM studies have confirmed that recombinant mutants of sunflower oleosin can form nanometric fibers, sheets, and vesicles depending on solution conditions . The vesicle membrane thickness correlates with increasing hydrophilic fraction for a fixed hydrophobic domain length, suggesting that the hydrophilic domains extend outward from the hydrophobic core of the membrane .

For researchers working with self-assembled oleosin structures, the existence of a bilayer membrane in vesicles can be verified through encapsulation experiments using hydrophobic dyes (e.g., Nile red) in the membrane and hydrophilic molecules (e.g., calcein) in the interior .

How can artificial oil bodies (AOBs) be effectively created and stabilized using recombinant oleosins?

Creating stable artificial oil bodies (AOBs) with recombinant oleosins involves several key methodological considerations:

Preparation protocol:

  • Express and purify recombinant oleosin (from E. coli or other systems)

  • Mix purified oleosin with phospholipids and desired oil phase

  • Homogenize the mixture using sonication or high-pressure homogenization

  • Purify AOBs through centrifugation and washing steps

Stability factors:

  • Oleosin concentration: Higher concentration improves stability but reaches a saturation point

  • Oleosin structure: Polyoleosins provide greater stability than single oleosin units

  • Oil:phospholipid ratio: Must be optimized for desired AOB size and stability

  • Buffer conditions: pH and ionic strength affect electrostatic interactions

Performance assessment:

  • Measure size distribution using dynamic light scattering

  • Assess stability through storage at various temperatures

  • Evaluate resistance to freeze-thaw cycles

  • Test emulsion stability under centrifugation stress

Prokaryotically expressed recombinant oleosins can be used to generate AOBs with properties similar to plant-derived oil bodies, making them valuable tools for studying oleosin function without the complexities of plant systems . The use of AOBs to analyze prokaryotically expressed modified oleosins offers substantial time savings compared to testing in transgenic plant systems .

Notably, polyoleosins (multiple oleosin units joined in tandem) significantly enhance AOB stability, with the degree of enhancement correlating with increasing oleosin repeat number .

What are the considerations for designing and expressing oleosin fusion proteins for biotechnological applications?

Designing effective oleosin fusion proteins requires careful consideration of multiple factors:

Design considerations:

  • Fusion site selection:

    • N-terminal fusion: Generally better for maintaining oil body targeting

    • C-terminal fusion: May be preferred for certain protein functions

    • Multiple fusion sites possible with polyoleosins

  • Linker design:

    • Include flexible amino acids (Gly, Ser) to reduce steric hindrance

    • Incorporate specific protease cleavage sites for protein release

    • Consider length to balance flexibility and stability

  • Expression system selection:

    • In planta: Allows direct incorporation into native oil bodies

    • E. coli: Faster screening but requires AOB reconstitution

    • Yeast: Intermediate option with post-translational capabilities

Application-specific considerations:

  • For protein purification:

    • Include specific cleavage sites between oleosin and target protein

    • Design washing protocols to remove contaminants while maintaining oil body integrity

    • Optimize release conditions for maximal yield

  • For enzyme immobilization:

    • Consider active site accessibility after fusion

    • Evaluate activity retention compared to free enzyme

    • Assess reusability of oleosin-immobilized enzymes

  • For pharmaceutical applications:

    • Evaluate biocompatibility of the oil body system

    • Consider controlled release properties

    • Address regulatory requirements for recombinant proteins

Several successful oleosin fusion proteins have been reported, including oleosin-tryptophan decarboxylase, oleosin-trypsin inhibitor, oleosin-chitinase, and oleosin-xylanase . These fusion proteins demonstrate the versatility of the oleosin system for various biotechnological applications, from enzyme immobilization to the production of bioactive compounds.

What protocols are most effective for purifying recombinant Helianthus annuus oleosin?

Purification of recombinant sunflower oleosin requires specialized protocols depending on the expression system:

From E. coli:

  • Cell lysis: Sonication or pressure homogenization in appropriate buffer

  • Inclusion body isolation: Centrifugation (5,000-10,000 × g, 10 min)

  • Inclusion body washing: Multiple washes with detergent (e.g., Triton X-100)

  • Solubilization: Use of strong denaturants (8M urea or 6M guanidine HCl)

  • Refolding: Gradual dilution or dialysis into detergent-containing buffer

  • Affinity purification: If fusion tags are present (e.g., His-tag, MBP)

  • Proteolytic cleavage: Remove fusion tags (e.g., with factor Xa)

  • Secondary purification: Size exclusion or ion exchange chromatography

From transgenic plants:

  • Seed homogenization: Mill seeds in aqueous buffer

  • Oil body flotation: Centrifugation to float oil bodies

  • Washing: Multiple washing steps with different buffers

  • Salt/pH adjustments: To remove contaminating proteins

  • Proteolytic cleavage: If oleosin fusion proteins are used

  • Separation: Remove oil bodies containing cleaved oleosin by centrifugation

  • Further purification: Conventional downstream processing

For structural studies of the hydrophobic domain, additional steps have been employed, such as sequential digestion with factor Xa followed by trypsin and Staphylococcus V8 protease to isolate the hydrophobic domain from the N- and C-terminal regions of the oleosin .

How can researchers assess and optimize the functional properties of recombinant oleosins?

Assessment and optimization of recombinant oleosin functionality involves multiple analytical approaches:

Structural characterization:

  • Circular dichroism spectroscopy: Determine secondary structure content

  • FTIR spectroscopy: Analyze protein conformation

  • Fluorescence spectroscopy: Probe tertiary structure

  • Differential scanning calorimetry: Measure thermal stability

Functional assessment:

  • Emulsion stability tests:

    • Monitor phase separation over time

    • Measure resistance to centrifugation

    • Assess freeze-thaw stability

    • Evaluate thermal cycling resistance

  • Oil body characterization:

    • Size distribution analysis (dynamic light scattering)

    • Microscopy (confocal, electron microscopy)

    • Zeta potential measurement

    • Rheological properties

Optimization strategies:

  • Protein engineering approaches:

    • Create polyoleosins for enhanced stability

    • Modify hydrophobic/hydrophilic balance

    • Introduce specific amino acid substitutions

    • Design fusion proteins for added functionality

  • Formulation optimization:

    • Adjust oil:protein:phospholipid ratios

    • Modify buffer composition and pH

    • Incorporate stabilizing additives

    • Optimize homogenization conditions

Experimental comparisons have shown that polyoleosins with increasing repeat numbers (e.g., 3 and 6 oleosin repeats) progressively enhance oil body stability and emulsion properties compared to single oleosin units . This provides researchers with a tunable system for optimizing functional properties based on specific application requirements.

What analytical techniques are most informative for studying oleosin-mediated self-assembly and suprastructure formation?

Multiple analytical techniques provide complementary information about oleosin self-assembly:

TechniqueInformation ProvidedAdvantages
Cryo-TEMDirect visualization of nanostructuresPreserves native hydrated state
Dynamic light scatteringSize distribution of assembliesFast, non-destructive
Small-angle X-ray scatteringInternal structure, periodicityWorks with complex mixtures
Circular dichroismSecondary structure contentMonitors structural changes
Fluorescence microscopyReal-time visualization of large structuresWorks with labeled proteins
Atomic force microscopySurface topography, mechanical propertiesHigh resolution of surface features

When studying self-assembled structures from recombinant oleosin mutants, researchers have observed nanometric fibers, sheets, and vesicles depending on solution ionic strength and protein hydrophilic fraction . The correlation between vesicle membrane thickness and increasing hydrophilic fraction for a fixed hydrophobic domain length provides important structure-function insights .

For giant vesicles, the bilayer membrane structure can be verified through localized encapsulation experiments using:

  • Hydrophobic dyes (e.g., Nile red) to label the membrane

  • Hydrophilic molecules (e.g., calcein) to label the interior aqueous compartment

Interestingly, circular dichroism analysis has revealed that changes in nanostructural morphology in oleosin mutants are not necessarily related to changes in secondary structure, suggesting that higher-order interactions drive self-assembly behavior .

What are the most promising directions for genetic engineering of Helianthus annuus oleosin?

Several promising directions for genetic engineering of sunflower oleosin warrant further investigation:

  • Domain-focused engineering:

    • Modifying the hydrophobic domain length to create custom membrane thicknesses

    • Engineering the proline knot region to alter membrane curvature

    • Adjusting hydrophilic domains to tune interaction with aqueous environments

  • Functional modifications:

    • Introducing stimulus-responsive elements (pH, temperature, light)

    • Incorporating bioactive peptides at specific positions

    • Designing switchable assembly/disassembly mechanisms

  • Application-specific variants:

    • Engineering oleosins for enhanced vaccine delivery

    • Developing variants optimized for drug encapsulation

    • Creating oleosins with improved food-grade emulsification properties

  • Cross-species oleosin chimeras:

    • Combining structural elements from different plant species

    • Creating hybrid oleosins with enhanced stability or functionality

    • Exploring evolutionary conservation and divergence

Research on polyoleosins (multiple oleosin repeats) has already demonstrated the potential to enhance thermal stability of emulsions, control release of lipid-soluble compounds, and provide stronger anchoring of fused peptides to oil bodies . This approach could be extended to create more complex architectures with multiple functionalities.

How might advanced genomic and proteomic technologies enhance our understanding of oleosin structure-function relationships?

Advanced -omics technologies offer powerful approaches to elucidate oleosin structure-function relationships:

Genomic approaches:

  • CRISPR/Cas9 genome editing:

    • Create precise modifications in oleosin genes

    • Study effects of specific residue changes in native context

    • Generate oleosin knockout lines to assess physiological impacts

  • Comparative genomics:

    • Analyze oleosin evolution across plant species

    • Identify conserved functional domains

    • Discover natural variants with unique properties

Proteomic approaches:

  • Hydrogen-deuterium exchange mass spectrometry:

    • Map solvent-accessible regions

    • Identify protein-protein interaction interfaces

    • Monitor conformational changes upon oil body binding

  • Crosslinking mass spectrometry:

    • Determine spatial proximity of amino acids

    • Validate structural models

    • Identify interaction partners

  • Cryo-electron microscopy:

    • Resolve high-resolution structures of oleosin assemblies

    • Visualize oleosin organization on oil body surfaces

    • Determine structural differences between variants

The sunflower genome sequence provides a foundation for understanding the genetic basis of oil metabolism , which can inform oleosin engineering. Integrating genomic, transcriptomic, and proteomic data can reveal regulatory networks controlling oleosin expression and oil body formation, offering new targets for biotechnological applications.

What interdisciplinary approaches might advance the biotechnological applications of recombinant Helianthus annuus oleosin?

Advancing biotechnological applications of recombinant sunflower oleosin requires interdisciplinary approaches:

  • Biophysics-materials science interface:

    • Characterize mechanical properties of oleosin-stabilized interfaces

    • Develop computational models of oleosin self-assembly

    • Create hybrid materials combining oleosins with synthetic polymers

  • Pharmaceutical sciences collaboration:

    • Optimize oleosin-based drug delivery vehicles

    • Develop targeted delivery systems using oleosin-antibody fusions

    • Evaluate biocompatibility and biodistribution profiles

  • Food science integration:

    • Engineer oleosins for improved emulsion stability in food systems

    • Develop processing methods compatible with oleosin-stabilized emulsions

    • Address regulatory considerations for food applications

  • Synthetic biology approaches:

    • Design artificial genetic circuits controlling oleosin expression

    • Create multipurpose oil bodies with multiple functionalities

    • Develop cell-free systems for oleosin production

Research has already demonstrated that recombinant oleosin can be used to produce vaccines, food products, cosmetics, and nutraceuticals , highlighting the versatility of this system. The ability to create tunable protein suprastructures from recombinant oleosin mutants offers additional possibilities for developing novel biomaterials with precise control over surfactant chemistry and biological functionality .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.