Recombinant Helianthus annuus Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Functional Roles in PSI Assembly

Ycf4 acts as a non-enzymatic assembly factor facilitating PSI maturation:

  • Complex stabilization: Binds nascent PSI subunits, preventing degradation during assembly .

  • Cofactor integration: Assists in chlorophyll and iron-sulfur cluster insertion into PSI apoproteins .

  • Regulatory role: Modulates expression of chloroplast genes (rbcL, atpB, atpL) and nuclear-encoded LHC proteins, linking PSI assembly with transcriptional regulation .

Table 1: Key Protein Interactions of Ycf4

Interacting PartnerInteraction Site (Ycf4)Binding Strength (Hydrogen Bonds)Functional Role
LHC subunits (LHCA1–4)C-terminus (91 aa)8–12Stabilizes PSI-LHC supercomplex
RuBisCO (RbcL/RBCS)C-terminus6–9Supports carbon fixation machinery
PSI core (PsaB/PsaC)C-terminus7–10Enables PSI subunit docking
Data adapted from in-silico docking studies in tobacco .

3.1. Knockout Phenotypes

  • Tobacco (ΔYCF4):

    • Lethal photoautotrophy: Complete knockout mutants fail to survive without external sucrose due to defective chloroplast ultrastructure (rounded shape, disorganized thylakoids) .

    • Chlorophyll deficiency: Total chlorophyll reduced by ~16% in young leaves and >99% in mature tissues .

    • Transcriptional dysregulation: Downregulation of rbcL, LHC, and ATP synthase genes (atpB, atpL) .

  • Chlamydomonas:

    • Non-essential but critical: Partial PSI assembly persists, but mutants show reduced PSI stability .

3.2. Recombinant Ycf4 Applications

  • Purification strategies: Tandem affinity purification (TAP-tag) with IgG agarose and calmodulin columns successfully isolates Ycf4 complexes .

  • Structural studies: Transmission electron microscopy (TEM) reveals Ycf4-containing complexes as large, irregular particles (~20 nm diameter) .

Table 2: Physiological Impact of Ycf4 Knockout in Tobacco

ParameterWild-TypeΔYCF4 MutantChange (%)
Chlorophyll content (mg/g)3.12.6-16%
Photosynthetic rate (µmol CO₂/m²/s)12.43.2-74%
Stomatal conductance (mol H₂O/m²/s)0.450.12-73%
Data sourced from .

Controversies and Unresolved Questions

  • Essentiality debate:

    • Krech et al. (2012) reported photoautotrophic growth in tobacco with partial Ycf4 knockout (N-terminal deletion) .

    • Later studies (2022) demonstrated lethality in full-knockout mutants, attributing viability in partial knockouts to retained C-terminal function .

  • Species-specific roles: While Ycf4 is indispensable in tobacco and Chlamydomonas, its necessity in other plants like H. annuus remains unconfirmed.

Implications for Sunflower Research

Extrapolating from model systems, Ycf4 in H. annuus likely:

  • Coordinates PSI assembly under high-light stress, critical for sunflower’s adaptability.

  • Interacts with nuclear-encoded LHC proteins to optimize light harvesting.

  • Serves as a potential engineering target for enhancing photosynthetic efficiency in crops.

Future Directions

  • Structural resolution: Cryo-EM studies of recombinant sunflower Ycf4 complexes.

  • Gene editing: CRISPR-based knockout in H. annuus to validate functional conservation.

  • Stress response assays: Testing Ycf4 expression under drought or high-light conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
ycf4
Target Protein Sequence
MSCRSEHIWIEPIKGARKTSNFCWAIILFLGSLGFLLVGTSSYLGRNLISLFPSQEIVFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDIKDGIVCIFRWGFPGKNRRVFLRF LIKDIQSVRIEVKEGIYARRVLYMDIRGQGAIPLTRTDENFTPREMEQKAAELAYFLRVP IEVF
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Database Links

KEGG: han:4055659

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of Ycf4 in photosystem I assembly?

Ycf4 functions as a critical assembly factor for photosystem I (PSI), acting as a scaffold for the organization and integration of PSI subunits during biogenesis. Studies in Chlamydomonas reinhardtii have demonstrated that Ycf4 forms a stable complex exceeding 1500 kD that contains various PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Pulse-chase protein labeling experiments reveal that the PSI polypeptides associated with this Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, supporting Ycf4's role as a scaffold for PSI assembly .

When investigating Ycf4 function in Helianthus annuus, researchers should employ similar biochemical approaches while accounting for potential species-specific variations. Experimental protocols should include membrane protein extraction with non-ionic detergents, followed by biochemical techniques like sucrose gradient ultracentrifugation and ion exchange chromatography to isolate and characterize Ycf4-containing complexes.

Is Ycf4 essential for photosynthesis across different plant species?

This question addresses one of the most controversial aspects of Ycf4 research. Evidence points to species-specific differences in the essentiality of Ycf4. While most studies agree on its role in PSI assembly, whether plants can survive without it varies significantly.

StudyKnockout StrategyFindingsPhenotype
Krech et al. (2012)Partial knockout (93 of 184 amino acids from N-terminus)Non-essential; permits slow autotrophic growthReduced PSI content but photoautotrophic
Reported in search result Complete gene knockoutEssential; plants unable to survive photoautotrophicallyLight green phenotype becoming pale yellow; requires external carbon

The complete deletion of YCF4 from tobacco chloroplasts resulted in plants that were unable to survive photoautotrophically, with growth severely hampered without an external carbon supply . The contradictory results are likely due to differences in knockout strategies, with the partial knockout retaining the functionally important C-terminal domain .

For Helianthus annuus research, this discrepancy highlights the importance of designing knockout experiments that target the complete gene sequence rather than partial deletions, particularly when evaluating essentiality.

What methods are most effective for generating recombinant Ycf4 protein for functional studies?

When producing recombinant Helianthus annuus Ycf4 for functional studies, researchers should consider the following methodological approach:

  • Gene optimization: Codon optimization for the expression system of choice, considering that chloroplast genes often have different codon usage than common expression hosts.

  • Expression system selection: Bacterial expression systems (E. coli) are appropriate for structural studies, while plant-based transient expression systems may better preserve functional characteristics.

  • Protein solubilization: As a thylakoid membrane protein, Ycf4 requires appropriate detergents for solubilization. Studies in Chlamydomonas used sucrose gradient ultracentrifugation and ion exchange chromatography to purify the Ycf4 complex .

  • Affinity purification strategies: Tandem affinity purification (TAP) tags have been successfully used with Ycf4 in Chlamydomonas reinhardtii and could be adapted for Helianthus annuus Ycf4 .

  • Functional verification: Complementation assays with knockout mutants provide the strongest evidence for recombinant protein functionality.

This methodological framework ensures proper expression and purification while maintaining the protein's functional characteristics for subsequent studies.

How do the protein interaction partners of Ycf4 differ between model systems and Helianthus annuus?

Understanding the protein interaction network of Ycf4 across species provides insight into both conserved and species-specific aspects of PSI assembly. In Chlamydomonas reinhardtii, Ycf4 shows an intimate and exclusive association with the opsin-related protein COP2 . This association may be unique to Chlamydomonas, as COP2 is also involved in eyespot function, a structure not present in land plants .

For Helianthus annuus Ycf4 interaction studies, researchers should employ:

  • Co-immunoprecipitation with anti-Ycf4 antibodies: This approach can identify native interaction partners in sunflower chloroplasts.

  • Yeast two-hybrid or split-GFP assays: These techniques can verify direct binary interactions between Ycf4 and candidate partners.

  • Comparative proteomic analysis: Cross-species comparison of Ycf4-associated proteins can distinguish conserved from species-specific interactions.

Studies indicate that the C-terminus (91 amino acids) of Ycf4 is particularly important for interactions with other chloroplast proteins, as revealed by in-silico protein-protein interaction analyses . This region should be preserved in any recombinant construct designed for interaction studies.

What ultrastructural changes occur in chloroplasts following Ycf4 deletion, and what do they reveal about its function?

Transmission electron microscopy (TEM) studies of ΔYcf4 tobacco mutants have revealed significant ultrastructural alterations in chloroplasts compared to wild-type plants. These changes include:

  • Altered chloroplast morphology: Chloroplasts in knockout plants were rounded rather than oblong and smaller than those in wild-type plants .

  • Disrupted thylakoid organization: Thylakoid membranes were less densely packed, with grana stacks exhibiting a loss of orderly structure .

  • Vesicular structures: Vesicular formations appeared in mutant chloroplasts as thylakoid membranes became less organized .

How does Ycf4 depletion affect the transcriptome profile beyond photosynthesis-related genes?

Transcriptome analysis of tobacco ΔYcf4 plants revealed surprising effects extending beyond PSI assembly. While PSI, PSII, and ribosomal gene expression remained unchanged, significant decreases were observed in transcripts for:

  • rbcL (Ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit)

  • Light-Harvesting Complex (LHC) genes

  • ATP Synthase genes (atpB and atpL)

These findings suggest that Ycf4 has functions beyond PSI assembly, potentially involving transcriptional regulation of key photosynthetic genes. For Helianthus annuus research, RNA-seq analysis comparing wild-type and Ycf4-depleted plants would help establish:

  • Whether similar transcriptional changes occur in sunflower

  • Sunflower-specific transcriptional responses to Ycf4 depletion

  • Potential regulatory pathways connecting Ycf4 to gene expression

What experimental approaches can resolve the contradictory findings regarding Ycf4 essentiality?

The conflicting reports on Ycf4 essentiality in tobacco highlight the need for careful experimental design in Helianthus annuus studies. To resolve such contradictions, researchers should implement:

  • Complete versus partial gene deletion: Generate both partial (N-terminal) and complete Ycf4 knockouts to directly compare phenotypes within the same species and growth conditions .

  • Domain-specific complementation: Test the ability of different Ycf4 domains to rescue knockout phenotypes, with particular focus on the C-terminal region (91 aa) implicated in protein interactions .

  • Varied carbon supplementation: Assess growth across a gradient of external carbon sources (0-3% sucrose) to quantify photosynthetic competence .

  • Comprehensive physiological measurements: Include photosynthetic rate (A), transpiration rate (E), stomatal conductance (gs), sub-stomatal CO₂ (Ci), and photosynthetic photon flux density measurements to fully characterize photosynthetic capacity .

This systematic approach would provide definitive evidence regarding Ycf4 essentiality in Helianthus annuus and clarify whether the observed species differences reflect true biological variation or methodological discrepancies.

How do the structural features of Ycf4 relate to its function in PSI assembly?

Electron microscopy of purified Ycf4-containing complexes from Chlamydomonas reinhardtii revealed large structures measuring approximately 285 × 185 Å, which may represent several large oligomeric states . These dimensions suggest that Ycf4 forms extensive scaffolding structures that facilitate the spatial organization of PSI components during assembly.

For Helianthus annuus Ycf4 structural-functional studies, researchers should consider:

  • Cryo-electron microscopy: This technique could provide high-resolution structural information about sunflower Ycf4 complexes.

  • Structure-guided mutagenesis: Based on structural data, targeted mutations can identify functionally critical regions.

  • Cross-linking mass spectrometry: This approach can map the spatial relationships between Ycf4 and its interaction partners within assembly complexes.

Understanding these structural features would provide mechanistic insights into how Ycf4 facilitates PSI assembly in Helianthus annuus and potentially explain species-specific differences in Ycf4 function.

What are the optimal conditions for expressing recombinant Helianthus annuus Ycf4 in heterologous systems?

When expressing recombinant Helianthus annuus Ycf4, researchers should consider the following optimization parameters:

  • Expression system selection:

    • Bacterial systems (E. coli) offer high yield but may require refolding

    • Yeast systems provide eukaryotic folding machinery

    • Plant-based transient expression preserves native post-translational modifications

  • Solubilization strategies for membrane proteins:

    • Test multiple detergents (DDM, LMNG, digitonin)

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Evaluate nanodiscs for maintaining native-like membrane environment

  • Expression temperature optimization:

    • Lower temperatures (16-20°C) often improve folding of complex proteins

  • Induction conditions:

    • For IPTG-inducible systems, concentrations between 0.1-1.0 mM

    • Consider auto-induction media for gradual protein expression

Given that Ycf4 is a membrane-associated protein involved in large protein complexes, maintaining its structural integrity during recombinant expression is crucial for functional studies.

How can researchers effectively design CRISPR-Cas9 strategies for studying Ycf4 in Helianthus annuus?

When designing CRISPR-Cas9 approaches for Ycf4 modification in sunflower, consider:

  • Target site selection:

    • Avoid targeting only the N-terminal region, as this may lead to incomplete knockouts that retain C-terminal functionality

    • Design multiple gRNAs targeting different regions to ensure complete gene disruption

  • Validation strategies:

    • PCR and Southern blot analysis to confirm targeted modifications

    • Western blotting with specific antibodies against Ycf4-derived peptide sequences

    • Sequencing to verify exact genetic modifications

  • Phenotypic analysis pipeline:

    • Growth assessment under varied carbon supplementation (0-3% sucrose)

    • Chlorophyll content measurement across leaf development stages

    • TEM analysis of chloroplast ultrastructure

    • Transcriptome analysis focusing on photosynthesis-related genes

This comprehensive approach ensures accurate characterization of Ycf4 function in Helianthus annuus while avoiding the pitfalls of incomplete gene disruption that have led to contradictory results in other species.

What methods are most appropriate for analyzing Ycf4-dependent PSI assembly in Helianthus annuus?

To effectively study Ycf4-dependent PSI assembly in sunflower, researchers should employ a multi-faceted approach:

  • Biochemical characterization:

    • Blue native PAGE to visualize intact PSI complexes and assembly intermediates

    • Sucrose gradient ultracentrifugation to separate protein complexes based on size

    • Immunoblotting against PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, PsaF) to track assembly progression

  • Pulse-chase protein labeling:

    • This technique revealed that PSI polypeptides associated with the Ycf4 complex in Chlamydomonas are newly synthesized and partially assembled

    • Adapt this approach to track PSI subunit incorporation in sunflower chloroplasts

  • Mass spectrometry analysis:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify components of Ycf4-containing complexes

    • Quantitative proteomics to compare PSI subunit abundance between wild-type and Ycf4-modified plants

  • Spectroscopic measurements:

    • 77K fluorescence spectroscopy to assess PSI/PSII ratios

    • P700 absorption measurements to quantify functional PSI centers

This methodological framework provides complementary data on both the structural and functional aspects of Ycf4-mediated PSI assembly in Helianthus annuus.

How might the differential findings on Ycf4 essentiality inform biotechnological approaches to enhancing photosynthesis in Helianthus annuus?

The contrasting findings regarding Ycf4 essentiality present both challenges and opportunities for photosynthesis enhancement in sunflower. The discovery that complete Ycf4 deletion renders tobacco plants unable to survive photoautotrophically , while partial deletion allows slow autotrophic growth , suggests that modulating Ycf4 expression levels rather than complete deletion might be a viable strategy.

For Helianthus annuus biotechnology applications, researchers might consider:

  • Ycf4 overexpression: Increasing Ycf4 levels could potentially enhance PSI assembly efficiency, particularly under stress conditions that affect protein complex stability.

  • Domain-specific engineering: Given the importance of the C-terminal domain for protein interactions , engineered variants with enhanced interaction capabilities could improve assembly processes.

  • Conditional expression systems: Developing systems for temporal control of Ycf4 expression could allow dynamic optimization of photosynthetic machinery during different developmental stages or environmental conditions.

  • Cross-species complementation: Testing whether Ycf4 variants from highly efficient photosynthetic organisms can enhance PSI assembly in sunflower could identify beneficial structural features.

These approaches require careful phenotypic assessment, including measurements of photosynthetic rate, stomatal conductance, and sub-stomatal CO₂ to quantify photosynthetic improvements.

What is the relationship between Ycf4 function and environmental stress responses in Helianthus annuus?

The relationship between Ycf4 and environmental stress tolerance represents an important frontier in photosynthesis research. Studies in Chlamydomonas revealed that decreasing COP2 levels increased the salt sensitivity of Ycf4 complex stability , suggesting potential connections between Ycf4 function and abiotic stress responses.

To investigate this relationship in Helianthus annuus, researchers should design experiments addressing:

  • Stress-induced changes in Ycf4 expression: Quantitative RT-PCR and western blot analysis of Ycf4 levels under various stresses (drought, heat, high light, salinity).

  • Ycf4 complex stability under stress conditions: Blue native PAGE and immunoblotting to assess complex integrity during stress exposure.

  • Comparative stress responses: Evaluate physiological and molecular stress responses in wild-type versus Ycf4-modified plants.

  • Transcriptome analysis under stress conditions: RNA-seq comparing stress-responsive gene expression between wild-type and Ycf4-modified plants could reveal Ycf4-dependent stress signaling pathways.

Understanding this relationship could inform strategies for developing more stress-tolerant sunflower varieties with improved photosynthetic efficiency under suboptimal growing conditions.

How does the evolutionary conservation of Ycf4 across photosynthetic organisms inform our understanding of its function in Helianthus annuus?

Evolutionary analysis of Ycf4 across diverse photosynthetic organisms provides context for understanding its function in Helianthus annuus. The presence of Ycf4 in the chloroplast genomes of diverse photosynthetic organisms suggests strong evolutionary conservation, yet functional studies indicate species-specific differences.

A comprehensive evolutionary analysis should include:

  • Sequence conservation analysis: Identify highly conserved regions likely critical for core functions versus variable regions that might confer species-specific adaptations.

  • Structural modeling: Predict structural features based on conserved domains and compare across species.

  • Comparative genomics: Analyze synteny and co-evolution with other photosynthetic genes.

  • Phylogenetic distribution of functional data: Map known functional characteristics (essentiality, interaction partners) onto a phylogenetic tree to identify evolutionary patterns.

This evolutionary perspective could explain why complete Ycf4 deletion is lethal in some species but not others, and inform the design of complementation experiments using Ycf4 genes from different evolutionary backgrounds in Helianthus annuus.

What are the key challenges in developing specific antibodies against Helianthus annuus Ycf4?

Developing specific antibodies against Helianthus annuus Ycf4 presents several challenges:

  • Membrane protein antigenicity: As a thylakoid membrane protein, Ycf4 contains hydrophobic domains that may be poorly immunogenic.

  • Cross-reactivity concerns: High conservation of certain domains across species may lead to antibody cross-reactivity.

  • Low natural abundance: Ycf4's relatively low abundance in thylakoid membranes complicates both immunization and validation.

To address these challenges, researchers have successfully generated specific antibodies against tobacco Ycf4 using peptide sequences . For Helianthus annuus Ycf4, researchers should:

  • Select multiple peptide epitopes: Choose sequences from both hydrophilic domains and species-specific regions.

  • Validate specificity: Test against wild-type and Ycf4-depleted samples to confirm specificity .

  • Consider recombinant protein immunization: Express soluble domains of Helianthus annuus Ycf4 for immunization.

  • Employ monoclonal antibody technology: This approach can yield highly specific antibodies against individual epitopes.

Well-characterized antibodies are essential tools for studying Ycf4 expression, localization, and protein-protein interactions in sunflower.

How can researchers distinguish between direct and indirect effects of Ycf4 deletion in transcriptome studies?

The observation that Ycf4 deletion affects the transcription of genes beyond those directly involved in PSI assembly raises important questions about distinguishing direct regulatory roles from indirect effects. To address this challenge, researchers should implement:

  • Time-course studies: Analyze transcriptome changes at multiple time points following inducible Ycf4 depletion to identify primary versus secondary effects.

  • Comparison with other PSI assembly mutants: Compare transcriptome profiles of Ycf4 mutants with other PSI assembly factor mutants to identify Ycf4-specific effects.

  • Chromatin immunoprecipitation (ChIP) studies: If Ycf4 has a direct role in transcriptional regulation, ChIP could identify direct DNA interactions.

  • Targeted complementation: Express specific domains of Ycf4 in knockout backgrounds to identify which regions are responsible for transcriptional effects.

  • Metabolome analysis: Changes in metabolite profiles could explain indirect transcriptional effects through metabolic signaling pathways.

This multi-faceted approach would help distinguish between direct regulatory functions of Ycf4 and indirect effects resulting from impaired photosynthesis or altered chloroplast homeostasis.

What novel techniques could advance our understanding of Ycf4 function in Helianthus annuus?

Several emerging technologies could significantly enhance our understanding of Ycf4 function in sunflower:

  • Cryo-electron tomography: This technique could visualize Ycf4-mediated PSI assembly in native membrane environments at near-atomic resolution.

  • Single-molecule tracking: Fluorescently labeled Ycf4 could be tracked in vivo to understand its dynamics during PSI assembly.

  • Proximity labeling proteomics (BioID or APEX): These techniques could identify transient interaction partners of Ycf4 during different stages of PSI assembly.

  • Chloroplast-specific CRISPR technologies: Developing tools for precise chloroplast genome editing in Helianthus annuus would facilitate more sophisticated genetic studies.

  • Optogenetic approaches: Light-controlled Ycf4 variants could allow temporal manipulation of PSI assembly processes.

  • Nanobody development: Sunflower-specific nanobodies against Ycf4 could enable immunoprecipitation of native complexes with minimal disruption.

These advanced techniques would provide unprecedented insights into the dynamic aspects of Ycf4 function in PSI assembly and potentially reveal additional roles in chloroplast biology.

How might comparative studies between model systems and Helianthus annuus Ycf4 inform crop improvement strategies?

Comparative studies between model systems and Helianthus annuus Ycf4 could reveal species-specific adaptations relevant to crop improvement:

  • Cross-species complementation: Testing whether Ycf4 from model systems can functionally replace sunflower Ycf4 would identify conserved and divergent functional aspects.

  • Chimeric protein analysis: Creating chimeric proteins with domains from different species could identify regions responsible for species-specific phenotypes.

  • Comparative stress responses: Analyzing how Ycf4 function responds to environmental stresses across species could identify adaptive mechanisms.

  • Natural variation studies: Examining Ycf4 sequence and expression variation across sunflower varieties with different photosynthetic efficiencies could identify beneficial alleles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.