Recombinant Helianthus annuus Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in PSII

PsbB (CP47) serves as the primary antenna protein in PSII, binding ~16 chlorophyll molecules to facilitate light absorption and energy transfer to the reaction center (D1/D2 proteins) . It also interacts with extrinsic proteins (e.g., PsbO, PsbU) to stabilize the oxygen-evolving complex .

PSII Stability and Stress Response

  • Photoprotection: PsbB mutants in cyanobacteria exhibit impaired PSII activity under high light, highlighting its role in stabilizing the reaction center .

  • Chlorophyll Binding: His residues in psbB coordinate chlorophyll, enabling energy transfer to D1/D2. Disruption of these residues (e.g., R448G mutation) reduces PSII efficiency .

Agricultural Relevance

  • Seed Development: In oilseed crops like sunflower, psbB supports photosynthetic efficiency, directly impacting triacylglycerol (TAG) synthesis .

  • Antibody Utility: Polyclonal antibodies (e.g., AS04 038) detect psbB across plants, algae, and cyanobacteria, facilitating studies on PSII dynamics .

Table 1: Functional Domains of PsbB

DomainFunction
Chlorophyll-BindingCoordinates 16 chlorophyll molecules for light absorption .
Transmembrane HelicesAnchors protein in thylakoid membrane, enabling electron transport .
Extrinsic Protein InteractionStabilizes extrinsic subunits (e.g., PsbO) for water oxidation .

Table 2: Comparative Features of PsbB Across Species

SpeciesSequence IdentityKey Function
Helianthus annuusN/ACore antenna in PSII; supports TAG synthesis .
Synechocystis~76% vs. spinachEssential for PSII activity; His residues bind chlorophyll .
ArabidopsisN/ALoading control for PSII repair studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in your order notes for customized preparation.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us and we will prioritize its inclusion in the development process.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Helianthus annuus (Common sunflower)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPSWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE VWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPVTVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQAI
Uniprot No.

Target Background

Function
CP47, a core component of photosystem II (PSII), plays a crucial role in light-driven photosynthesis. It binds chlorophyll and facilitates the primary photochemical reactions within PSII. PSII, a light-powered water:plastoquinone oxidoreductase, harnesses light energy to extract electrons from water, producing oxygen and a proton gradient. This gradient is subsequently utilized for ATP synthesis.
Database Links

KEGG: han:4055665

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 chlorophyll apoprotein in Photosystem II?

CP47 is one of the integral antennae of the oxygen-evolving Photosystem II (PSII) that is responsible for efficient excitation energy transfer to the PSII reaction center. This critical protein contains approximately 16 chlorophyll molecules arranged in a specific pattern that facilitates energy capture and transfer. The CP47 protein's function is essential for initiating the electron transfer cascade that drives oxygenic photosynthesis .

In Helianthus annuus (common sunflower), CP47 maintains the highly conserved structure seen across photosynthetic organisms, reflecting its fundamental importance in the photosynthetic apparatus. The protein's primary role involves capturing light energy and efficiently channeling it to the reaction center, where charge separation occurs.

What is the gene psbB and how does it relate to CP47?

The psbB gene encodes the CP47 chlorophyll apoprotein in photosynthetic organisms. This gene resides in the chloroplast genome of plants, including Helianthus annuus. When working with recombinant systems, researchers must isolate the psbB gene sequence from genomic DNA or cDNA libraries for subsequent cloning into appropriate expression vectors.

For effective recombinant expression, several genetic considerations must be addressed:

  • Codon optimization for the chosen expression system

  • Addition of appropriate regulatory elements for transcription and translation

  • Incorporation of purification tags for downstream processing

  • Strategic placement of restriction sites for modular cloning approaches

The psbB gene sequence can be modified for experimental purposes such as site-directed mutagenesis to probe structure-function relationships or fusion with reporter proteins to track expression and localization.

What are the structural characteristics of CP47?

CP47 exhibits several key structural features essential to its function:

  • Transmembrane organization with six membrane-spanning α-helical domains anchored in the thylakoid membrane

  • Sixteen chlorophyll binding sites with specific protein interactions that create unique electrostatic environments for each chlorophyll

  • Large extrinsic loop regions that interact with other PSII components

  • Histidine residues that serve as ligands coordinating magnesium atoms at the center of chlorophyll molecules

  • Binding sites for accessory pigments including β-carotene

The chlorophyll molecules within CP47 are arranged in a precise three-dimensional configuration that facilitates directional energy transfer toward the reaction center. The specific protein environment around each chlorophyll molecule tunes its spectroscopic properties, creating an energetic landscape that guides excitation energy along preferred pathways .

Why study recombinant Helianthus annuus CP47 specifically?

Helianthus annuus (common sunflower) possesses several distinct characteristics that make it valuable for CP47 research:

  • Agricultural significance as a major crop with remarkable photosynthetic efficiency

  • Exceptional adaptation to varying light conditions and environmental stresses

  • Unique heliotropic behavior (sun tracking) that maximizes light capture efficiency

  • Distinctive photosynthetic responses to high light conditions

Studying CP47 from Helianthus annuus can provide insights into:

  • Photosynthetic adaptations in crops with high solar tracking ability

  • Mechanisms underlying efficient light energy utilization

  • Potential applications for improving photosynthetic performance in other species

  • Evolutionary adaptation of photosynthetic machinery

The recombinant approach offers significant advantages over extraction from native tissue:

  • Production of sufficient quantities for structural and functional studies

  • Ability to introduce specific modifications for structure-function studies

  • Isolation of the protein from its complex native environment for mechanistic studies

  • Potential for high-throughput screening of mutations or conditions

How does CP47 contribute to the function of Photosystem II?

CP47 performs several critical functions within the Photosystem II complex:

  • Light harvesting - The 16 chlorophyll molecules bound to CP47 absorb photons across specific wavelengths of visible light, significantly expanding the spectral range utilized for photosynthesis.

  • Excitation energy transfer - CP47 efficiently channels the captured excitation energy to the reaction center chlorophylls, where charge separation occurs. The mapping of site energies among these chlorophyll molecules is essential for understanding this energy transfer pathway .

  • Structural support - CP47 provides essential structural stability to the PSII complex, maintaining the precise three-dimensional organization required for efficient photochemistry.

  • Assembly scaffold - During biogenesis of PSII, CP47 serves as a critical assembly factor, providing binding sites for other subunits and cofactors.

  • Photoprotection - Evidence suggests CP47 may participate in regulatory processes that protect PSII from photodamage under excess light conditions.

What computational methods are most effective for studying CP47 structure-function relationships?

Based on current research, a multi-layered computational approach yields the most comprehensive insights into CP47 structure-function relationships:

  • Quantum Mechanical (QM) methods for chlorophyll properties:

    • Time-dependent density functional theory (TD-DFT) with range-separated functionals provides accurate calculations of chlorophyll excitation energies

    • Modern functionals (e.g., CAM-B3LYP, ωB97X-D) offer improved description of charge-transfer states critical for photosynthetic processes

  • Quantum Mechanics/Molecular Mechanics (QM/MM) for protein-pigment interactions:

    • As demonstrated in the research on CP47, this approach effectively quantifies the electrostatic effect of the protein environment on chlorophyll site energies

    • Allows calculation of spectroscopic properties while accounting for the native protein environment

    • Balances computational efficiency with accuracy for large pigment-protein systems

  • Molecular Dynamics (MD) simulations for structural dynamics:

    • All-atom MD simulations with specialized force fields for chlorophyll parameters

    • Analysis of protein flexibility, water networks, and hydrogen bonding patterns

    • Assessment of structural stability for isolated recombinant protein versus native complex

  • Energy transfer calculations:

    • Exciton models incorporating calculated site energies and coupling values

    • Modified Redfield theory for intermediate coupling regime appropriate for photosynthetic complexes

    • Network analysis of energy transfer pathways to identify critical connections

Computational MethodApplicationAdvantagesLimitations
TD-DFT/Range-separated functionalsChlorophyll excitation energiesAccurate for excited statesComputationally intensive
QM/MMProtein-pigment interactionsCaptures environmental effectsRequires careful parameterization
MD SimulationsStructural dynamicsReveals conformational flexibilityLimited timescales
Exciton ModelsEnergy transfer pathwaysComprehensive energy landscapeDepends on accurate parameters

The research described in source represents a state-of-the-art application of these methods, demonstrating that a multiscale QM/MM approach utilizing full time-dependent density functional theory can successfully compute the excitation energies of all CP47 chlorophylls in a complete membrane-embedded photosystem.

How can we determine the excitation energies of chlorophyll molecules in CP47?

Determining chlorophyll excitation energies in CP47 requires a combination of advanced experimental and computational approaches:

Experimental Methods:

Computational Approaches:

Based on research findings , the most effective computational strategy involves:

  • Building a complete structural model of CP47 in its native membrane environment

  • Performing QM/MM calculations with:

    • Chlorophyll molecules treated with full quantum mechanical methods

    • Protein environment represented by molecular mechanics force fields

    • Range-separated density functionals for accurate excited state properties

The research demonstrated in successfully quantified the electrostatic effect of the protein on chlorophyll site energies, identifying the most red-shifted chlorophylls (B3, followed by B1) in CP47. This ranking differs from previous hypotheses in the literature, highlighting the importance of high-level quantum chemical calculations.

For recombinant Helianthus annuus CP47, this methodology would need to be applied to a homology model based on available crystal structures, with sequence-specific modifications to account for species differences in the protein environment surrounding the chlorophylls.

How does the protein environment affect chlorophyll site energies in CP47?

The protein environment creates unique electrostatic and structural conditions for each chlorophyll molecule in CP47, significantly modulating their spectroscopic properties:

  • Electrostatic effects:

    • Charged amino acids create local electric fields that shift chlorophyll absorption spectra

    • Polar residues form hydrogen bonds with chlorophyll peripheral groups

    • The specific distribution of charges around each chlorophyll creates a unique energetic landscape

  • Structural constraints:

    • The protein matrix holds chlorophylls in precise orientations

    • Slight distortions of the chlorophyll macrocycle by protein interactions affect electronic properties

    • Distance and orientation between chlorophylls determine excitonic coupling strength

  • Specific interactions:

    • Histidine coordination to the central magnesium directly influences electronic structure

    • Aromatic residues engage in π-stacking interactions with the chlorophyll ring system

    • Water molecules in the protein matrix can form bridging hydrogen bonds

Research using QM/MM approaches has revealed that these protein-pigment interactions can shift chlorophyll site energies by several hundred wavenumbers . The analysis identified chlorophylls B3 and B1 as the most red-shifted in CP47, differing from previous literature hypotheses and demonstrating the value of high-level quantum chemical calculations.

This protein-induced tuning of chlorophyll properties is not merely a structural artifact but represents evolutionary optimization of energy transfer pathways within the photosynthetic apparatus of Helianthus annuus.

What are the optimal expression systems for recombinant production of CP47 from Helianthus annuus?

Expressing functional recombinant CP47 presents significant challenges due to its complex membrane protein nature and requirement for chlorophyll incorporation. Several expression systems offer distinct advantages and limitations:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, fast growth, well-established protocolsLacks chloroplast machinery, poor membrane protein foldingUse specialized strains (C41/C43), fusion tags, lower temperature
CyanobacteriaNative-like lipid environment, chlorophyll synthesisLower yields, genetic manipulation challengesPhotosynthetic mutants as background, inducible promoters
Green algae chloroplastsEukaryotic chloroplast environmentTechnical difficulty, longer growth cyclesCodon optimization, selectable markers, light regime adjustment
Cell-free systemsAvoids toxicity issues, allows supplementationHigher cost, lower yieldsAddition of membranes/nanodiscs, chlorophyll supplementation

A methodological workflow for optimizing recombinant CP47 expression would include:

  • Gene preparation:

    • PCR amplification of psbB from Helianthus annuus

    • Codon optimization for chosen expression system

    • Addition of purification tags (preferably at positions known not to interfere with folding)

  • Expression screening:

    • Small-scale expression trials across multiple systems

    • Western blot analysis with anti-CP47 antibodies

    • Chlorophyll fluorescence to assess functional pigment incorporation

  • Optimization parameters:

    • Temperature and light conditions

    • Induction timing and duration

    • Media composition including supplements

    • Membrane-mimetic environments for cell-free systems

  • Functional validation:

    • Absorption spectroscopy to verify chlorophyll incorporation

    • Circular dichroism to assess protein secondary structure

    • Fluorescence lifetime measurements to evaluate energy transfer capability

Successful expression of functional recombinant CP47 requires careful consideration of the complete experimental pipeline from gene to purified protein, with particular attention to maintaining the protein's complex structural and functional integrity.

How can site-directed mutagenesis be used to investigate CP47 function?

Site-directed mutagenesis offers a powerful approach for systematically investigating structure-function relationships in CP47. Strategic targeting of specific residues can provide insights into chlorophyll binding, protein stability, energy transfer pathways, and interactions with other PSII components.

Key targets for mutagenesis:

  • Chlorophyll-binding residues:

    • Histidine ligands coordinating chlorophyll magnesium

    • Residues forming hydrogen bonds with chlorophyll peripheral groups

    • Amino acids creating the electrostatic environment around red-shifted chlorophylls B3 and B1

  • Protein-protein interface residues:

    • Amino acids at contact surfaces with D1, D2, and other PSII subunits

    • Residues involved in assembly and stability of the complex

  • Evolutionarily conserved residues:

    • Identification of functionally critical amino acids through sequence alignment

    • Special focus on conserved residues with unknown function

Example experimental design for CP47 mutagenesis study:

Mutation TargetRationaleExpected EffectAnalysis Methods
His114Ala (B3 ligand)Disruption of most red-shifted chlorophyll bindingAltered spectral properties, disrupted energy transferAbsorption spectroscopy, fluorescence decay measurements
Glu235GlnModify electrostatic environment near chlorophyll B1Spectral shift, altered energy transfer dynamicsCD spectroscopy, QM/MM calculations
Trp185PheSubtle alteration of aromatic interactionProbe π-stacking contribution to spectral tuningHigh-resolution fluorescence, computational modeling
Arg189GluCharge reversal near critical chlorophyllMajor alteration of site energyAbsorption spectroscopy, protein stability assays

For recombinant Helianthus annuus CP47, the mutagenesis workflow would involve:

  • Designing mutations based on homology models aligned with available crystal structures

  • Creating mutant constructs using PCR-based site-directed mutagenesis

  • Expressing wild-type and mutant proteins under identical conditions

  • Purifying proteins with equivalent protocols to ensure comparable samples

  • Performing comprehensive spectroscopic and functional characterization

  • Correlating experimental results with computational predictions

This integrated experimental and computational approach allows systematic decoding of the structure-function relationships in CP47, providing insights into the molecular basis of efficient light harvesting in Helianthus annuus.

What challenges exist in purifying functional recombinant CP47?

Purifying functional recombinant CP47 presents several formidable challenges that must be addressed through careful methodological approaches:

  • Membrane protein solubilization:

    • CP47 contains multiple transmembrane helices requiring careful detergent selection

    • Common detergents include n-dodecyl-β-D-maltoside (DDM), digitonin, and LMNG

    • Optimization of detergent concentration is critical to prevent protein aggregation while minimizing delipidation

  • Maintaining chlorophyll binding:

    • The 16 chlorophyll molecules are essential for function but can dissociate during purification

    • Purification buffers must be supplemented with chlorophyll to prevent loss

    • Light exposure must be minimized to prevent photooxidative damage

  • Structural stability:

    • Outside its native membrane environment, CP47 can lose its native conformation

    • Recombinant CP47 may show instability in certain regions as suggested by molecular dynamics simulations

    • Stabilization strategies include lipid supplementation and carefully optimized buffer conditions

  • Protein-protein interactions:

    • In vivo, CP47 exists in complex with other PSII components that stabilize its structure

    • Isolation may disrupt these stabilizing interactions

    • Co-expression with interacting partners may improve stability and functionality

Optimized purification protocol:

  • Membrane preparation:

    • Gentle cell disruption methods (French press or sonication with cooling)

    • Differential centrifugation to isolate membrane fractions

    • Membrane washing to remove peripheral proteins

  • Solubilization:

    • Careful screening of detergent type and concentration

    • Inclusion of glycerol (10-20%) and appropriate salt concentration

    • Addition of lipids to maintain a native-like environment

  • Chromatographic purification:

    • Affinity chromatography (if tagged)

    • Ion exchange chromatography for removing contaminants

    • Size exclusion chromatography to isolate properly folded protein

  • Quality control:

    • Absorption spectroscopy to verify chlorophyll content and ratios

    • Circular dichroism to assess secondary structure

    • Fluorescence emission to evaluate energy transfer capability

Throughout the purification process, samples should be protected from light, maintained at low temperature (typically 4°C), and handled with minimal exposure to air to prevent oxidation of pigments and sensitive amino acids.

How can researchers study energy transfer pathways in recombinant CP47?

Studying energy transfer pathways in recombinant CP47 requires an integrated approach combining advanced spectroscopic techniques with theoretical modeling:

Experimental techniques:

  • Steady-state spectroscopy:

    • Absorption spectroscopy to characterize ground state properties

    • Fluorescence emission and excitation spectroscopy to map energy transfer

    • Circular dichroism to probe excitonic coupling between chlorophylls

  • Time-resolved spectroscopy:

    • Ultrafast transient absorption (femtosecond to picosecond timescale)

    • Time-correlated single photon counting for fluorescence lifetimes

    • Two-dimensional electronic spectroscopy (2DES) to correlate excitation and emission energies

    • Pump-probe spectroscopy with varied excitation wavelengths to target specific chlorophyll pools

Theoretical modeling:

  • Excitonic model construction:

    • Incorporation of calculated site energies from QM/MM approaches

    • Determination of electronic coupling between chlorophylls

    • Calculation of spectral densities for system-bath interactions

  • Energy transfer simulations:

    • Modified Redfield theory for intermediate coupling regime

    • Hierarchical equations of motion (HEOM) for quantum coherence effects

    • Förster theory for weakly coupled chlorophylls

Methodological workflow:

  • Preparation of pure, functional recombinant CP47 with verified chlorophyll content

  • Spectroscopic characterization:

    • Room and low-temperature (77K) absorption and fluorescence

    • Identification of spectral signatures for different chlorophyll pools

    • Assignment of spectral features to specific chlorophylls based on QM/MM calculations

  • Time-resolved measurements:

    • Ultrafast transient absorption with global and target analysis

    • Extraction of energy transfer rate constants

    • Construction of energy transfer model with associated timescales

  • Model validation and refinement:

    • Site-directed mutagenesis to disrupt specific energy transfer steps

    • Comparison of wild-type and mutant energy transfer patterns

    • Iterative refinement of the energy transfer model

This combined approach allows researchers to construct a comprehensive map of how excitation energy flows through the CP47 complex in Helianthus annuus, providing insights into the fundamental mechanisms underlying efficient light harvesting in photosynthetic systems.

What are the differences in CP47 between Helianthus annuus and model organisms like Arabidopsis thaliana?

Comparative analysis of CP47 between Helianthus annuus and model organisms provides insights into evolutionary adaptations and species-specific optimizations of photosynthetic machinery:

Sequence and structural comparisons:

  • Chlorophyll binding regions:

    • Histidine ligands coordinating chlorophyll molecules are strictly conserved

    • Surrounding residues show species-specific variations that affect the electrostatic environment

    • These variations potentially fine-tune site energies for adaptation to different light conditions

  • Protein-protein interaction interfaces:

    • Residues mediating interactions with other PSII components

    • Co-evolutionary patterns with interacting partners

    • Variations potentially affecting assembly dynamics and complex stability

  • Extrinsic regions:

    • Generally more variable than transmembrane domains

    • May reflect species-specific regulatory mechanisms

    • Could influence interactions with extrinsic proteins

Functional differences:

Helianthus annuus, as a sun-tracking plant adapted to high-light environments, likely displays adaptations in its photosynthetic apparatus compared to shade-tolerant Arabidopsis:

  • Spectroscopic properties:

    • Potential shifts in chlorophyll site energies optimized for specific light environments

    • Different energy transfer pathways or efficiencies

    • Adaptations for photoprotection under high light conditions

  • Photoprotective mechanisms:

    • Variations in regulatory sites involved in non-photochemical quenching

    • Different sensitivity to photoinhibition

    • Species-specific interactions with photoprotective proteins

Methodological approach for comparative studies:

  • Sequence analysis:

    • Multiple sequence alignment of psbB from diverse species

    • Mapping of variations onto structural models

    • Identification of conservation patterns and positively selected residues

  • Recombinant expression:

    • Production of CP47 from both species under identical conditions

    • Creation of chimeric proteins to isolate functionally important regions

    • Comparative spectroscopic analysis of pure proteins

  • Computational analysis:

    • Homology modeling of species-specific structures

    • QM/MM calculations to compare chlorophyll site energies

    • Prediction of excitation energy transfer differences

This comparative approach can reveal how evolutionary pressures have shaped the photosynthetic apparatus in different plant species and provide insights into adaptations that might be valuable for crop improvement strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.