Recombinant Helicobacter acinonychis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Evolutionary Insights

Comparative Genomics:

  • H. acinonychis diverged from H. pylori ~200,000 years ago via a host jump to large felines .

  • The atpB gene is highly conserved between H. acinonychis and H. pylori, with ~92% sequence identity .

Key Mutations:

  • Strain Sheeba retains functional atpB despite extensive gene fragmentation in other loci (e.g., vacA, cagPAI) .

  • No frameshifts or premature stop codons observed in atpB, unlike ~8% of other genes in H. acinonychis .

Functional Role in Bacterial Physiology

ATP Synthase Complex:

  • Subunit a partners with subunits b, b', and c to form the F0 proton channel .

  • Critical for maintaining proton motive force and ATP synthesis in acidic gastric environments .

Target for Pathogenicity Studies:

  • Used to investigate ATP synthase inhibition as a potential therapeutic strategy .

  • Enables comparative studies of energy metabolism in Helicobacter species .

Biotechnological Use:

  • Serves as an antigen in ELISA for detecting H. acinonychis infections in captive felines .

  • Facilitates structural biology efforts to map bacterial ATP synthase mechanisms .

Future Directions

  • Drug Development: Targeting ATP synthase subunits could disrupt bacterial energetics without harming host mitochondria .

  • Evolutionary Studies: Analyzing atpB conservation provides insights into host adaptation and horizontal gene transfer in Helicobacter .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
atpB; Hac_1196; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Helicobacter acinonychis (strain Sheeba)
Target Names
atpB
Target Protein Sequence
MEHRVFTVANFFSSNHDFITGFFVVLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAI LSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPSFESPTASWSFTLVLALIVFFYY HFEGIRVQGFFKYFAHFAGPVKWLAPFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLI MLLLVPWVIPVAPFMVLFFMGILQAFVFMILTYVYLAGAVLTDEGH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.