Recombinant Helicobacter acinonychis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Helicobacter acinonychis and Lipoprotein Signal Peptidase (LspA)

Helicobacter acinonychis is a Gram-negative bacterium closely related to Helicobacter pylori, the human gastric pathogen. While H. pylori primarily infects humans, H. acinonychis colonizes large felines such as cheetahs, lions, and tigers . Lipoprotein signal peptidase (LspA), also known as signal peptidase II, is an essential enzyme in bacterial lipoprotein biosynthesis. It cleaves the signal peptide from prolipoproteins after their diacylation by Lgt, enabling maturation and membrane anchoring . Recombinant LspA refers to the enzyme produced via genetic engineering, enabling biochemical and functional studies.

Functional Studies and Enzyme Activity

LspA activity is critical for lipoprotein maturation:

  • Substrate Processing: Cleaves signal peptides N-terminal to the conserved cysteine in lipobox sequences, enabling lipid anchoring .

  • Resistance Mechanisms: In Acinetobacter baumannii, mutations in lipoprotein signal peptides (e.g., lirL) reduce LspA substrate sensitivity, conferring resistance to globomycin analogs . Similar adaptations may occur in Helicobacter under selective pressure.

Comparative Analysis with H. pylori LspA

  • Genetic Divergence: H. acinonychis and H. pylori share ~92% sequence identity in core genes , suggesting conserved LspA function.

  • Host Adaptation: H. acinonychis lacks virulence factors like the cag pathogenicity island , but retains lipoprotein pathways critical for membrane biogenesis.

  • Lipoprotein Diversity: H. acinonychis lipoproteins may exhibit unique post-translational modifications (e.g., sialylation) , influencing LspA substrate specificity.

Implications for Antibacterial Research and Therapeutic Development

  • Drug Target Potential: LspA is a validated target for antibiotics like globomycin . Inhibiting H. acinonychis LspA could inform therapies for related pathogens.

  • Resistance Studies: Characterizing H. acinonychis LspA variants could elucidate resistance mechanisms in Helicobacter .

  • Evolutionary Insights: Comparative studies of LspA in H. acinonychis and H. pylori may reveal host adaptation strategies .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.

Synonyms
lspA; Hac_1530; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Helicobacter acinonychis (strain Sheeba)
Target Names
lspA
Target Protein Sequence
MLKTTQTSLFIFIGVFLLIFGTDQAIKYAILEGFRYESSIIDIVLVFNKGVAFSLLSFLE GSLKYLQILLILGLFIFLMRQIELFKAHTIEFGMVFGAGVSNILDRFVHGGVVDYVYYHY GFDFAIFNFADVMIDVGVGVLLIRQFFFKQKQNKIKA
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of LspA in Helicobacter species lipoprotein biosynthesis?

LspA (prolipoprotein signal peptidase or signal peptidase II) is an essential enzyme in the lipoprotein biosynthesis pathway of gram-negative bacteria, including Helicobacter species. In this pathway, after the prolipoprotein diacylglyceryl transferase (Lgt) adds a diacylglyceride to the cysteine sulfhydryl of the preprolipoprotein, LspA cleaves the amino acids preceding this modified cysteine. This cleavage results in a diacylated apolipoprotein, which can then be further modified by apolipoprotein N-acyltransferase (Lnt) to produce the mature triacylated lipoprotein . Studies in H. pylori demonstrate that LspA is essential for bacterial growth, highlighting its critical function in cellular physiology .

How does H. acinonychis LspA compare structurally to other Helicobacter LspA proteins?

While the specific structure of H. acinonychis LspA has not been fully characterized, insights can be drawn from its closely related species. H. acinonychis and H. pylori share significant genetic similarity, with approximately 2% base substitution difference across various genes . Given this close relationship, their LspA proteins likely share substantial structural and functional similarities. In H. pylori, functional complementation studies demonstrated that its LspA can restore growth in E. coli strains with conditionally regulated lspA expression, suggesting conservation of fundamental structural elements required for activity across diverse bacterial species . A comparative genomic analysis would be valuable to identify specific conserved features and unique elements in H. acinonychis LspA.

What growth conditions are optimal for H. acinonychis before LspA isolation?

For optimal growth of H. acinonychis prior to LspA isolation, microaerobic conditions (5% O₂, 10% CO₂, 85% N₂) at 37°C are essential. The bacterial cultures should be grown on brain heart infusion agar supplemented with 7% horse blood and 0.4% IsoVitaleX. For selective growth, antibiotics such as amphotericin B (8 μg/ml), trimethoprim (5 μg/ml), and vancomycin (6 μg/ml) can be included in the media . The growth phase significantly impacts protein expression patterns in Helicobacter species, as demonstrated by variations in small RNA expression profiles across exponential, stationary, and coccoid phases . Therefore, harvesting cells during late exponential phase may provide optimal yields of functional LspA for subsequent purification and analysis.

What methodologies are most effective for expressing recombinant H. acinonychis LspA?

Based on successful approaches with related bacterial membrane proteins, the following methodology would be most effective:

  • Vector selection: A pET-based expression system with a C-terminal His-tag separated by a TEV protease cleavage site provides efficient purification options while allowing tag removal

  • Host optimization: E. coli strains specifically designed for membrane protein expression (C41(DE3) or C43(DE3)) offer better yields than standard BL21(DE3)

  • Expression conditions: Induction with 0.1-0.3 mM IPTG at 18°C for 16-20 hours in media supplemented with 0.5% glycerol improves proper folding

  • Membrane extraction: Gentle lysis using lysozyme treatment followed by membrane fraction isolation via ultracentrifugation

  • Solubilization: Screening of detergents including n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), and digitonin at concentrations just above their critical micelle concentration

  • Functional validation: Complementation assay using E. coli conditional mutants where the native lspA is under arabinose-inducible promoter control, similar to the approach described for H. pylori LspA

How can resistance mechanisms to LspA inhibitors be characterized in H. acinonychis?

Characterizing resistance mechanisms to LspA inhibitors in H. acinonychis requires a systematic approach:

  • Generation of resistant mutants: Expose H. acinonychis to sub-inhibitory concentrations of LspA inhibitors (such as globomycin or its analogs) with gradual increase until resistant colonies emerge

  • Whole-genome sequencing: Compare resistant mutants to parent strains to identify genetic alterations

  • Targeted gene analysis: Focus particularly on the lspA gene itself and genes encoding abundant lipoproteins, as mutations in these regions are likely resistance determinants

  • Functional validation: Introduce identified mutations into wild-type strains via homologous recombination to confirm their role in resistance

  • Mechanistic studies: Determine whether resistance results from altered drug binding, modified outer membrane permeability, or compensatory pathways

This approach parallels studies in A. baumannii where mutations in a previously uncharacterized lipoprotein (named lirL) conferred resistance to LspA inhibitors . Similar uncharacterized lipoproteins may exist in H. acinonychis that could mediate inhibitor resistance.

What role does LspA play in H. acinonychis pathogenesis and host adaptation?

The role of LspA in H. acinonychis pathogenesis likely centers on processing lipoproteins that mediate interactions with the host. While direct evidence from H. acinonychis is limited, parallels can be drawn from H. pylori studies:

  • Essential virulence factors: In H. pylori, LspA processes components of the Cag Type IV Secretion System (T4SS), particularly CagT, which is required for delivery of the CagA oncoprotein into host cells

  • Host adaptation: H. acinonychis strains isolated from different big cats (cheetahs, tigers, lions) show genetic variations , which may extend to lipoproteins involved in host adaptation

  • Immune evasion: Properly processed lipoproteins likely contribute to outer membrane integrity, potentially protecting against host immune defenses

  • Colonization factors: Lipoproteins may include adhesins or receptors that facilitate colonization of the gastric mucosa

To investigate these roles experimentally, conditional mutants of lspA could be created (since full knockouts may be lethal) and evaluated for altered colonization ability, immune stimulation, and persistence in appropriate model systems.

What is the optimal purification strategy for recombinant H. acinonychis LspA?

A multi-step purification strategy optimized for membrane proteins would yield the highest purity and activity:

  • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture His-tagged LspA, with washing gradients containing low imidazole concentrations (20-40 mM) to remove non-specific binding

  • Size exclusion chromatography: Separation on Superdex 200 column to isolate properly folded monomeric protein and remove aggregates

  • Buffer optimization: Screening of buffer conditions including pH range (7.0-8.0), salt concentration (100-300 mM NaCl), and glycerol content (5-10%) to maintain stability

  • Detergent exchange: If necessary, exchange to more stable detergents for long-term storage or specific applications

  • Activity verification: Enzymatic activity assessment using synthetic peptide substrates that mimic the lipobox region of known H. acinonychis lipoproteins

This approach would need to be empirically optimized, as the specific biochemical properties of H. acinonychis LspA may differ from other bacterial LspA proteins.

How can functional assays be designed to assess H. acinonychis LspA activity?

A robust functional assay for H. acinonychis LspA could employ the following design:

In vitro enzymatic assay:

  • Substrate preparation: Synthetic peptides (10-15 amino acids) containing the lipobox motif and modified with diacylglycerol at the conserved cysteine residue

  • Detection system: Fluorescence resonance energy transfer (FRET) peptides with donor-acceptor pairs flanking the cleavage site

  • Reaction conditions: 50 mM HEPES buffer (pH 7.5), 150 mM NaCl, 0.05% DDM, purified LspA (10-100 nM)

  • Controls:

    • Positive: H. pylori LspA (known to be functional)

    • Negative: Heat-inactivated enzyme and globomycin-inhibited reactions

  • Analysis: Initial velocity measurements across multiple substrate concentrations to determine kinetic parameters (Km, kcat)

Cell-based complementation assay:

  • E. coli strain preparation: Transform conditional lspA mutant (with arabinose-inducible native lspA) with plasmid encoding H. acinonychis LspA

  • Growth assessment: Compare growth curves in glucose-containing media (repressing native lspA) with and without IPTG induction of recombinant LspA

  • Quantification: Measure optical density over time and calculate growth rates

  • Validation: Western blot analysis of accumulation or depletion of unprocessed prolipoproteins

This dual approach allows both direct measurement of enzymatic activity and functional complementation assessment.

What proteomics approaches can identify the complete lipoprotein substrate profile of H. acinonychis LspA?

A comprehensive lipoprotein substrate profiling strategy would combine:

  • Bioinformatic prediction:

    • Genome-wide scanning for lipobox motifs ([L/V/I]-[A/S/T/G]-[G/A]-C)

    • Machine learning algorithms trained on known bacterial lipoproteins to identify atypical lipoboxes

  • Comparative proteomics:

    • Metabolic labeling with azide-modified fatty acids to tag lipoproteins

    • Click chemistry to attach biotin for streptavidin enrichment

    • LC-MS/MS analysis comparing wild-type with LspA-depleted conditions

    • Identification of proteins with N-terminal lipidation sites

  • Validation methodology:

    • Site-directed mutagenesis of predicted lipoboxes

    • Western blot analysis showing accumulation of unprocessed forms upon LspA inhibition

    • Pulse-chase experiments to track processing kinetics

This approach would generate a table of all H. acinonychis lipoproteins classified by:

  • Subcellular localization (outer vs. inner membrane)

  • Processing efficiency (high vs. low LspA affinity)

  • Conservation across Helicobacter species

  • Functional categories (structural, enzymatic, transport, etc.)

How should inconsistencies between H. acinonychis and H. pylori LspA experimental results be analyzed?

When analyzing inconsistencies between H. acinonychis and H. pylori LspA experimental results, consider this systematic approach:

This structured analysis helps distinguish between true biological differences and technical artifacts, leading to more robust interpretations of experimental data.

What are the implications of strain-specific variations in LspA function for Helicobacter research?

Strain-specific variations in LspA function have several important implications:

The variable homopolymeric G-repeat observed in different Helicobacter strains that affects small RNA-mediated regulation suggests that similar strain-specific variations might exist in lipoprotein processing pathways, warranting careful consideration in experimental design and data interpretation.

What emerging technologies could advance structural studies of recombinant H. acinonychis LspA?

Several cutting-edge technologies show promise for advancing structural studies of this challenging membrane protein:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structural determination without crystallization

    • Lipid nanodisc reconstitution to study LspA in a native-like membrane environment

    • Time-resolved cryo-EM to capture different conformational states during catalysis

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping regions of conformational flexibility

    • Identifying substrate binding sites and inhibitor interaction surfaces

    • Detecting structural changes upon substrate or inhibitor binding

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Cross-linking mass spectrometry to determine spatial relationships

    • Molecular dynamics simulations to understand conformational dynamics in membranes

  • Artificial intelligence applications:

    • AlphaFold2 and RoseTTAFold for accurate structural prediction

    • Machine learning approaches to predict substrate specificity

    • Computational screening of potential inhibitors based on predicted structures

These technologies would significantly enhance our understanding of H. acinonychis LspA structure-function relationships and facilitate rational drug design targeting this essential enzyme.

How can knowledge about H. acinonychis LspA inform drug discovery efforts against pathogenic Helicobacter species?

Knowledge about H. acinonychis LspA can inform drug discovery through several avenues:

  • Comparative inhibitor sensitivity profiling:

    • Testing LspA inhibitors like globomycin and analogs (such as G5132) against recombinant H. acinonychis LspA

    • Identifying structural features that confer increased potency or specificity

    • Developing structure-activity relationships specific to Helicobacter LspA enzymes

  • Resistance mechanism anticipation:

    • Characterizing potential resistance pathways before clinical deployment

    • Identifying lipoproteins that, when mutated, could confer resistance (similar to lirL in A. baumannii)

    • Designing inhibitor combinations that target multiple steps in the lipoprotein biosynthesis pathway

  • Essential lipoprotein identification:

    • Determining which LspA-processed lipoproteins are essential for H. acinonychis survival

    • Comparing these with essential lipoproteins in pathogenic Helicobacter species

    • Developing drugs targeting both LspA and its critical substrates

  • Translational research potential:

    • Using animal models infected with H. acinonychis to test LspA inhibitors in vivo

    • Evaluating pharmacokinetic properties required for effective inhibition

    • Assessing potential for resistance development under selection pressure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.