Recombinant Helicobacter acinonychis NADH-quinone oxidoreductase subunit K (nuoK)

What is the basic structure and function of Helicobacter acinonychis NADH-quinone oxidoreductase subunit K?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane-embedded protein component of the NADH dehydrogenase I complex (NDH-1) in Helicobacter acinonychis. This protein consists of 100 amino acids with the sequence: MIGLNHYLIVSGLLFCIGLAGMLKRKNILLLFSTEMLNAINIGFIAISKYIHNLDGQMFALFIIAIAASEVAIGLGLVILWFKKFKSLDIDSLNAMKG . The protein is highly hydrophobic, containing multiple transmembrane segments that anchor it within the bacterial inner membrane. As part of the respiratory chain complex I, nuoK participates in electron transfer processes critical for cellular energy production through oxidative phosphorylation.

The protein has the EC designation 1.6.99.5, classifying it within the oxidoreductase enzyme family that acts on NADH or NADPH with various acceptors. In Helicobacter acinonychis strain Sheeba, nuoK is encoded by the gene Hac_0214, which has been fully sequenced and characterized .

How does nuoK from H. acinonychis compare structurally with homologs from other bacterial species?

NuoK from H. acinonychis shows significant structural conservation with homologs from other bacteria, particularly within the Helicobacter genus. Comparative sequence analysis reveals:

• High sequence similarity with H. pylori nuoK (approximately 85-90% identity)

• Conserved hydrophobic regions corresponding to transmembrane domains

• Preserved functional motifs involved in quinone interaction

Unlike many other proteins in H. acinonychis, nuoK does not appear among the extensively fragmented genes that resulted from the species' evolutionary adaptation following the host jump from humans to large felines. This structural conservation suggests critical functional importance that has maintained selective pressure against mutations that could disrupt protein function .

What are the recommended conditions for handling recombinant H. acinonychis nuoK protein in laboratory settings?

For optimal stability and functionality of recombinant H. acinonychis nuoK protein:

• Store the protein at -20°C for short-term storage and at -20°C to -80°C for extended storage periods

• Avoid repeated freeze-thaw cycles as they can significantly compromise protein integrity

• For active research, maintain working aliquots at 4°C for up to one week

• The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized for stability

The hydrophobic nature of nuoK necessitates special handling considerations. Working with detergent-solubilized preparations or nanodisc reconstitution may improve protein stability during experimental manipulations. When designing experiments, consider the transmembrane nature of this protein and its native lipid environment.

What expression systems are most effective for producing recombinant H. acinonychis nuoK?

Successful expression of membrane proteins like nuoK requires specialized approaches:

E. coli-based expression systems:

• BL21(DE3) strains containing specific modifications for membrane protein expression

• C41(DE3) and C43(DE3) strains engineered to accommodate potentially toxic membrane proteins

• Codon-optimized constructs addressing rare codon usage in Helicobacter genes

Expression strategy recommendations:

• Use low temperature induction (16-20°C) to reduce inclusion body formation

• Employ mild inducers like low IPTG concentrations (0.1-0.5 mM) or auto-induction media

• Consider fusion tags that enhance membrane insertion and trafficking (e.g., MBP or SUMO)

• Co-express with chaperones that facilitate membrane protein folding

The specific challenges with nuoK expression stem from its highly hydrophobic transmembrane domains, which can cause toxicity and aggregation during overexpression. Selecting expression vectors with tightly regulated promoters helps control expression rates, allowing proper membrane insertion.

What purification strategies yield the highest purity and activity for recombinant nuoK protein?

Purification of membrane proteins like nuoK requires specialized techniques:

• Membrane isolation and solubilization:

  • Differential centrifugation to isolate membrane fractions

  • Screening of detergents (DDM, LMNG, digitonin) for optimal solubilization

  • Gentle solubilization at 4°C with detergent concentrations just above CMC

• Affinity chromatography:

  • IMAC (immobilized metal affinity chromatography) using histidine tags

  • Anti-tag antibody affinity columns for non-metal binding approaches

  • On-column detergent exchange during elution

• Secondary purification:

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Ion exchange chromatography for removal of nucleic acid contamination

• Quality assessment:

  • SDS-PAGE and Western blotting to confirm purity

  • Mass spectrometry to verify protein identity

  • Circular dichroism to assess secondary structure integrity

Preservation of activity requires maintaining an appropriate membrane-mimetic environment throughout purification, potentially utilizing nanodiscs or amphipols for stabilization of the purified protein in a near-native conformation.

How can researchers effectively study protein-protein interactions involving nuoK within the respiratory complex?

Investigating protein-protein interactions for membrane-embedded components like nuoK requires specialized approaches:

Crosslinking techniques:

• Chemical crosslinking with membrane-permeable reagents

• Photo-activatable crosslinkers for precise interaction mapping

• MS/MS analysis of crosslinked peptides to identify interaction interfaces

Co-purification strategies:

• Pull-down assays using tagged nuoK as bait for associated complex components

• Tandem affinity purification of intact respirasomes

• Sequential or differential detergent solubilization to map interaction strengths

Biophysical interaction methods:

• Microscale thermophoresis for quantifying interactions in detergent micelles

• Surface plasmon resonance with captured liposome-reconstituted protein

• Förster resonance energy transfer (FRET) between labeled complex components

In silico approaches:

• Molecular docking based on homology models

• Coevolution analysis to predict interaction surfaces

• Molecular dynamics simulations in membrane environments

These methods can reveal how nuoK integrates within the larger respiratory complex and how these interactions differ between H. acinonychis and related species like H. pylori.

What insights does nuoK provide into the evolutionary history of H. acinonychis following its host jump from humans to felines?

The nuoK gene offers valuable evolutionary insights within the context of H. acinonychis genomics:

Unlike many genes in H. acinonychis that underwent fragmentation following the host jump from humans to large felines, nuoK appears to have remained intact. This conservation suggests essential functionality that could not be compromised even during host adaptation. Comparative genomic analysis shows that while H. acinonychis has an unusually high number of fragmented genes (particularly those encoding outer membrane proteins), core metabolic functions including respiratory chain components have largely remained intact .

The estimated timeline for the host jump (50,000-400,000 years ago, with a likely date around 200,000 years ago) provides context for understanding selective pressures on nuoK during this evolutionary transition . While adaptation to the feline stomach environment led to significant genomic changes in H. acinonychis, the conservation of nuoK reflects the fundamental importance of cellular respiration across diverse host environments.

The genomic context surrounding nuoK may provide additional evolutionary insights, particularly whether synteny with neighboring genes has been preserved compared to the ancestral H. pylori arrangement.

How does nuoK functionality compare between H. acinonychis and H. pylori, and what does this reveal about bacterial adaptation?

Comparing nuoK between these closely related species that inhabit different hosts reveals:

Sequence conservation:

• High sequence identity reflecting core functional constraints

• Key catalytic and structural motifs preserved between species

• Similar transmembrane topology predictions

Functional adaptations:

• Subtle amino acid substitutions that may influence protein-lipid interactions in different host membrane environments

• Potential differences in regulatory elements controlling nuoK expression under different gastric conditions

• Context within respiratory chains that may have different optimal operating parameters in feline versus human stomachs

This comparative analysis highlights how core metabolic machinery remains conserved despite host jumps, with adaptations potentially occurring at the level of regulation and fine-tuning rather than wholesale protein redesign. The physiological demands of energy production apparently remained similar enough between human and feline gastric environments that major restructuring of respiratory chain components was unnecessary .

What techniques are most informative for studying the evolutionary relationship between H. acinonychis nuoK and homologs in other bacterial species?

Several complementary approaches provide insight into evolutionary relationships:

Phylogenetic analysis methods:

• Maximum likelihood tree construction using nuoK sequences from diverse Helicobacter species

• Bayesian inference approaches for estimating divergence times

• Selection pressure analysis using dN/dS ratios to identify conserved versus variable regions

Comparative genomics approaches:

• Synteny mapping to track genomic rearrangements surrounding nuoK

• Analysis of GC content and codon usage patterns as markers of horizontal gene transfer

• Evaluation of regulatory element conservation in promoter regions

Structural biology integration:

• Homology modeling to map sequence changes onto predicted structures

• Identification of co-evolving residues that maintain structural integrity

• Mapping of conserved interaction surfaces versus variable regions

Experimental evolution studies:

• Directed evolution under different selective pressures

• Complementation studies in heterologous hosts

• Site-directed mutagenesis to test functional impact of species-specific variations

This multi-faceted approach can place nuoK evolution within the broader context of the host jump event that gave rise to H. acinonychis approximately 200,000 years ago, when early humans were consumed by large felines, facilitating bacterial transfer .

How can researchers accurately measure the enzymatic activity of nuoK within the NADH dehydrogenase complex?

Measuring nuoK activity presents unique challenges as it functions as part of a multi-subunit complex:

Intact complex activity assays:

• Oxygen consumption measurements using polarography

• Spectrophotometric monitoring of NADH oxidation at 340 nm

• Artificial electron acceptor (ferricyanide, DCPIP) reduction assays

• Proton pumping assays using pH-sensitive fluorescent dyes

Reconstitution approaches:

• Proteoliposome reconstitution of purified complex I components

• Co-expression systems for assembling partial or complete complexes

• Complementation of nuoK-deficient bacterial strains

Site-directed mutagenesis strategy:

• Targeting conserved residues predicted to be functionally important

• Creating chimeric proteins with homologous regions from H. pylori

• Engineering reporter tags for monitoring assembly and activity

Data analysis considerations:

• Normalization to protein concentration and complex assembly efficiency

• Comparative analysis with other bacterial NADH dehydrogenase complexes

• Integration of activity data with structural predictions

What role might nuoK play in H. acinonychis virulence and adaptation to the feline gastric environment?

While primarily a respiratory chain component, nuoK may have broader implications for pathogenesis:

Metabolic adaptation considerations:

• NADH dehydrogenase activity influences bacterial energy production capacity under the unique chemical conditions of the feline stomach

• Maintenance of proton motive force supports various virulence-associated functions

• Adaptation to different nutrient availability between human and feline hosts

Potential links to colonization:

• Energy production capacity affects growth rate and competitive fitness

• Proton pumping activities may contribute to local pH management

• Respiratory chain function supports motility and chemotaxis systems

Host interaction considerations:

• Unlike outer membrane proteins that underwent extensive fragmentation following the host jump, core metabolic components like nuoK remained largely intact

• This pattern suggests indirect rather than direct interactions with host immunity

• Potential role in supporting expression of direct virulence factors

The evolutionary conservation of nuoK through the host jump (unlike many fragmented genes in H. acinonychis) suggests its critical importance in bacterial survival within the gastric niche, regardless of host species . This conservation contrasts with the adaptive strategy of gene fragmentation that affected numerous outer membrane proteins, potentially helping H. acinonychis evade feline immune responses.

How does nuoK interact with nickel metabolism in H. acinonychis, and what are the implications for bacterial physiology?

The relationship between nuoK and nickel metabolism represents an intriguing research area:

Nickel relevance in Helicobacter species:

• Helicobacter species possess specialized nickel binding- and histidine-rich proteins

• These proteins expanded during gastric adaptation of Helicobacter species

• Nickel is essential for urease activity, a critical virulence factor

Potential nuoK-nickel interactions:

• Complex I components may indirectly influence nickel homeostasis through energy-dependent transport systems

• Respiratory chain function affects intracellular redox state, potentially influencing metal coordination chemistry

• Energy-dependent chaperone systems required for nickel incorporation into metallo-enzymes

Research methodology for studying nickel-protein interactions:

• Immobilized metal affinity chromatography (IMAC) techniques can identify nickel-binding proteins

• Mass spectrometry approaches reveal nickel-binding protein dynamics

• Comparative proteomics can identify variations in nickel-dependent pathways between Helicobacter species

Studies examining histidine-rich proteins across Helicobacter species, including H. acinonychis, reveal patterns of expansion during gastric adaptation . Understanding the relationship between energy metabolism (involving nuoK) and nickel utilization provides insight into the integrated physiology of these specialized gastric pathogens.

What are the most common technical challenges when working with recombinant nuoK, and how can researchers overcome them?

Working with membrane proteins like nuoK presents several technical challenges:

Expression challenges:

• Low expression yields due to toxicity - Address by using tightly regulated expression systems and lower induction temperatures

• Inclusion body formation - Try fusion partners that enhance solubility or specialized membrane protein expression strains

• Improper membrane insertion - Consider signal sequence optimization or membrane-targeting fusion tags

Purification obstacles:

• Detergent selection issues - Systematic screening of different detergent classes, focusing on mild options like DDM, LMNG, or digitonin

• Protein aggregation during concentration - Add stabilizing agents like glycerol or specific lipids; use gentle concentration methods

• Co-purifying contaminants - Implement multi-step purification strategies including ion exchange and size exclusion chromatography

Stability concerns:

• Rapid activity loss - Maintain strict temperature control and consider addition of stabilizing cofactors

• Precipitation during storage - Optimize buffer components including pH, ionic strength, and glycerol concentration

• Heterogeneity in preparation - Use analytical SEC and dynamic light scattering to monitor sample homogeneity

Assay interference:

• Detergent effects on activity assays - Control for detergent effects with appropriate blanks and controls

• Difficulty distinguishing nuoK contribution from whole complex activity - Design partial complex reconstitution experiments

• Limited quantity of active protein - Develop miniaturized assay formats with enhanced sensitivity

Implementing these strategies can help overcome the inherent challenges of working with this challenging but biologically significant membrane protein.

What experimental design considerations are crucial when comparing nuoK function between different Helicobacter species?

Meaningful comparative studies require careful experimental design:

Expression system standardization:

• Use identical expression constructs with species-specific nuoK sequences

• Standardize growth conditions, induction parameters, and harvest timing

• Verify equivalent expression levels through quantitative Western blotting

Purification consistency:

• Apply identical purification protocols across all species variants

• Confirm comparable purity through multiple analytical methods

• Assess protein stability and homogeneity for all variants

Functional assay considerations:

• Develop assays that isolate nuoK contribution from other variables

• Include appropriate controls for species-specific differences in assay compatibility

• Perform complementation experiments in standardized genetic backgrounds

Data analysis approach:

• Use multiple technical and biological replicates to ensure reproducibility

• Apply appropriate statistical tests for comparative analyses

• Correlate functional differences with sequence and structural variations

By implementing these design principles, researchers can attribute observed functional differences to genuine biological variations rather than methodological inconsistencies, enabling meaningful insights into evolutionary adaptations across Helicobacter species.

How can structural models of nuoK be validated experimentally, and what techniques provide the most reliable structural data?

Validating structural models of membrane proteins requires integrating computational and experimental approaches:

Cross-linking and mass spectrometry:

• Chemical cross-linking to identify proximity relationships between residues

• Mass spectrometry analysis of cross-linked peptides to validate predicted distances

• Comparison of experimental cross-link patterns with those predicted by structural models

Mutagenesis and functional analysis:

• Systematic alanine-scanning mutagenesis of predicted functional residues

• Charge-reversal mutations to test predicted electrostatic interactions

• Introduction/removal of disulfide bonds to test structural proximity predictions

Spectroscopic approaches:

• Circular dichroism spectroscopy to validate secondary structure content

• Site-directed spin labeling combined with EPR to measure distances between labeled sites

• Fluorescence resonance energy transfer (FRET) between strategically placed fluorophores

Advanced structural techniques:

• Cryo-electron microscopy of the entire respiratory complex

• X-ray crystallography of nuoK in detergent micelles or lipidic cubic phase

• Solid-state NMR of reconstituted protein in native-like membranes

The integration of these complementary approaches provides a comprehensive validation strategy for structural models of nuoK, overcoming the limitations of any single technique and building confidence in the proposed structure-function relationships.

What emerging technologies could advance our understanding of nuoK structure and function?

Several cutting-edge approaches show promise for nuoK research:

Advanced membrane mimetics:

• Nanodiscs with native lipid compositions for functional reconstitution

• Polymer-encapsulated membrane proteins (SMALP technology)

• Cell-free expression directly into liposomes for native-like insertion

Structural biology innovations:

• Micro-electron diffraction (MicroED) for structural determination from microcrystals

• Integrative structural biology combining multiple experimental datasets

• AlphaFold2 and other AI-based structure prediction tools specifically optimized for membrane proteins

Single-molecule techniques:

• High-speed atomic force microscopy (HS-AFM) to observe conformational dynamics

• Single-molecule FRET to measure distance changes during catalytic cycles

• Nanopore recording of individual protein conductance properties

Gene editing approaches:

• CRISPR-Cas9 precise genome editing in Helicobacter species

• In situ tagging for visualization of nuoK localization and dynamics

• Scarless introduction of point mutations to test structure-function hypotheses

These emerging technologies could address persistent challenges in membrane protein research and provide unprecedented insight into nuoK's role within the respiratory complex and bacterial adaptation strategies.

How might research on H. acinonychis nuoK contribute to broader understanding of bacterial host adaptation mechanisms?

NuoK research has implications for fundamental evolutionary biology concepts:

Host jump adaptation models:

• Comparing conserved metabolic machinery versus host-interaction proteins during host adaptation

• Identifying selection pressures that maintain core functions across diverse host environments

• Understanding the balance between gene conservation, modification, and inactivation during host jumps

Metabolic adaptation frameworks:

• Exploring how energy production requirements shape bacterial evolution in new niches

• Identifying metabolic bottlenecks that constrain adaptation to new hosts

• Tracing co-evolution of interconnected metabolic pathways during host specialization

Pathogen evolution concepts:

• Testing hypotheses about the "economic" genomic evolution of host-adapted bacteria

• Examining the relationship between metabolic capacity and virulence potential

• Understanding how genomic preservation versus change reflects functional constraints

The H. acinonychis model system provides a unique window into bacterial host jumps, with nuoK representing conserved core machinery against the backdrop of dramatic genomic remodeling through gene fragmentation and horizontal gene acquisition that occurred after the ancient human-to-feline transmission event .

What are the most promising applications of H. acinonychis nuoK research in comparative Helicobacter pathogenesis studies?

NuoK research offers several translational research opportunities:

Comparative pathogenesis insights:

• Using nuoK as a stable reference point for evaluating host-specific adaptations in other proteins

• Examining how conserved metabolic functions support distinct virulence mechanisms across host-adapted Helicobacter species

• Identifying common principles of gastric adaptation shared between human and animal Helicobacter pathogens

Therapeutic target evaluation:

• Assessing respiratory chain components as potential broad-spectrum targets against multiple Helicobacter species

• Comparative analysis of inhibitor sensitivity across species to identify conserved vulnerabilities

• Structure-based design of species-selective inhibitors based on subtle structural differences

Model system development:

• Engineering chimeric or mutant nuoK variants to test host adaptation hypotheses

• Developing heterologous expression systems to study species-specific nuoK functions

• Creating experimental evolution platforms to simulate host adaptation processes

By leveraging H. acinonychis as a model for host jump dynamics, researchers gain insight into both fundamental evolutionary processes and potential intervention strategies for Helicobacter infections across various host species.