Recombinant Helicobacter acinonychis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; Hac_1031; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Helicobacter acinonychis (strain Sheeba)
Target Names
lgt
Target Protein Sequence
MNAWNTIYERFNPIAFSLGSIEVHWYGLAYACAIVIAFYMALRMIQKDPKRFPVARKDFE SYFLWAELGIVLGARIGYILIYEPNSSYYLTHFWQIFNPFDSHGNFIGIRGMSYHGGLVG FLIASYLYNRKDLKKLLIYLDLIAISLPLGYVFGRIGNFLNQELVGRIVPKDSHLGQMIG IVVDHELRYPSQLIEAFLEGVIVFLMVMWAKKHTKTHGLLIVVYGLGYSLMRFIAEFYRE PDSQLGVYFLNLSMGQILSLFMVIVSLGILLYATKNSKKIKEN
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine residue of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of H. acinonychis Lgt?

H. acinonychis Lgt catalyzes the attachment of a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved cysteine residue in bacterial prolipoproteins via a thioether bond. This modification represents the first critical step in lipoprotein biogenesis in Gram-negative bacteria. The reaction releases glycerol phosphate as a byproduct during the transfer of the diacylglyceryl group from phosphatidylglycerol to the peptide substrate containing the invariant cysteine residue. In the lipoprotein biosynthesis pathway, this modification precedes signal peptide cleavage by lipoprotein signal peptidase (LspA) and subsequent N-acylation by N-acyl transferase (Lnt) .

How conserved is H. acinonychis Lgt compared to other bacterial species?

H. acinonychis Lgt shares significant sequence homology with Lgt from other epsilon-proteobacteria, particularly H. pylori. Sequence analysis reveals conservation of critical catalytic residues found in E. coli Lgt, including the Y26, R143, and E151 residues (E. coli numbering) that are predicted to bind phosphatidylglycerol, and the HGGL motif (residues 115-118 in H. pylori Lgt) that may interact with the peptide substrate. Additionally, the H-bond network consisting of R155, R232, E236, and R239 in H. pylori Lgt (corresponding to R143, R239, E243, and R246 in E. coli Lgt) is preserved, supporting its role in catalyzing diacylglycerol transfer to prolipoproteins . The conservation of these residues suggests functional similarity despite H. acinonychis being approximately 8% genetically different from H. pylori reference strains .

What are the genetic characteristics of H. acinonychis that might affect Lgt research?

Genetic analysis of H. acinonychis strains has revealed two distinct groups: one isolated from cheetahs in a U.S. zoo and lions in a European circus, and another from a tiger and lion-tiger hybrid. PCR and DNA sequencing demonstrated that these strains lack the cag pathogenicity island and contain a degenerate vacuolating cytotoxin (vacA) gene. Sequence analysis of nine other genes showed approximately 2% base substitution difference between the two H. acinonychis groups, and about 8% difference from H. pylori . This genetic diversity should be considered when selecting a source strain for recombinant Lgt expression, as it may influence protein properties and experimental outcomes.

What expression systems are most efficient for recombinant H. acinonychis Lgt production?

For optimal expression of recombinant H. acinonychis Lgt, E. coli-based systems with T7 or similar strong promoters have proven effective. When designing expression constructs, researchers should consider that Lgt is a membrane protein with multiple transmembrane domains. The use of fusion tags (such as His6, MBP, or SUMO) can enhance solubility and facilitate purification. Expression in E. coli strains like BL21(DE3) or C41(DE3) (specifically designed for membrane proteins) at reduced temperatures (16-20°C) post-induction can improve proper folding and functional expression . Codon optimization for E. coli may be necessary given the AT-rich genome of Helicobacter species.

What are the critical considerations for purifying active H. acinonychis Lgt?

Purification of active H. acinonychis Lgt requires careful handling of membrane fractions and selection of appropriate detergents. The purification protocol should typically include:

  • Cell disruption by sonication or high-pressure homogenization

  • Isolation of membrane fractions by ultracentrifugation (100,000×g)

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or CHAPS)

  • Affinity chromatography using the fusion tag

  • Size exclusion chromatography for final purification

Throughout the purification process, maintaining a reducing environment with DTT or β-mercaptoethanol is essential to preserve the activity of thiol-containing proteins like Lgt. Additionally, including glycerol (10-20%) and phospholipids in the buffer systems can help maintain the native conformation and activity of the enzyme .

How can complementation assays validate the functionality of recombinant H. acinonychis Lgt?

To validate the functionality of recombinant H. acinonychis Lgt, complementation assays using E. coli conditional mutant strains where the expression of endogenous lgt is under the control of an arabinose-inducible promoter can be employed. In these systems, the strains grow in media supplemented with arabinose but fail to grow on media supplemented with glucose. Introduction of plasmids encoding H. acinonychis Lgt under the control of IPTG-inducible promoters (such as lacUV5 or trc) into these conditional E. coli strains can demonstrate functional complementation if growth is restored in glucose-containing media when IPTG is added . These assays provide strong evidence that the recombinant H. acinonychis Lgt functions as predicted.

What in vitro assays can effectively measure H. acinonychis Lgt activity?

The enzymatic activity of H. acinonychis Lgt can be effectively measured using a coupled luciferase-based assay that detects glycerol phosphate release. This assay monitors the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate containing the conserved cysteine residue. When phosphatidylglycerol substrate with a racemic glycerol moiety is used, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released as Lgt catalyzes the reaction . The detection method typically involves:

  • Reaction of Lgt with phosphatidylglycerol and the peptide substrate

  • Release of glycerol phosphate during the reaction

  • Detection of G3P through a coupled enzymatic reaction leading to luciferase-based luminescence

The peptide substrate commonly used is derived from the Pal lipoprotein (Pal-IAAC, where C is the conserved cysteine modified by Lgt). A mutant peptide with the conserved cysteine replaced by alanine (Pal-IAAA) serves as a negative control .

What are the optimal substrate conditions for H. acinonychis Lgt assays?

For optimal activity measurement of H. acinonychis Lgt, the following substrate conditions should be considered:

ParameterOptimal ConditionNotes
Peptide substratePeptide containing lipobox motif (L-A/S-G/A-C)Derived from known H. acinonychis lipoproteins
Phospholipid substratePhosphatidylglycerol (PG)E. coli PG often used in heterologous systems
pH7.0-8.0Typical range for optimal activity
Temperature30-37°CLower temperatures may increase stability
Divalent cations5-10 mM Mg²⁺May enhance activity
Detergent0.1-0.5% non-ionic detergentTo maintain enzyme solubility

The peptide substrate sequence should ideally contain the lipobox motif with the invariant cysteine residue that becomes modified. The reaction buffer typically includes Tris-HCl or HEPES buffer at pH 7.5, sodium chloride for ionic strength, and a reducing agent to maintain the thiol group of the cysteine residue in its reduced form .

How can potential inhibitors of H. acinonychis Lgt be identified and validated?

Potential inhibitors of H. acinonychis Lgt can be identified through a systematic approach combining in vitro and cellular assays:

  • Primary screening: High-throughput biochemical assays measuring inhibition of glycerol phosphate release using the luciferase-coupled detection method can identify compounds that inhibit Lgt activity in vitro. IC₅₀ values can be determined for promising compounds .

  • Secondary validation: Compounds should be tested against purified recombinant H. acinonychis Lgt to confirm direct inhibition rather than interference with the detection system.

  • Specificity assessment: Testing inhibitors against Lgt from other bacterial species (such as E. coli) can determine whether inhibition is specific to H. acinonychis Lgt or represents a broader-spectrum activity.

  • Cellular validation: Monitoring the accumulation of prolipoprotein intermediates via Western blot analysis provides evidence of on-target cellular activity. For example, inhibition of Lgt leads to accumulation of non-lipidated pro-Lpp forms, which can be detected using appropriate antibodies .

  • Resistance studies: Attempting to generate resistant mutants and sequencing the lgt gene in any resistant isolates can validate that observed effects are due to Lgt inhibition .

How does H. acinonychis Lgt compare functionally to H. pylori and E. coli Lgt?

Functional comparison studies of H. acinonychis Lgt with H. pylori and E. coli Lgt reveal both similarities and differences in their biochemical properties:

PropertyH. acinonychis LgtH. pylori LgtE. coli Lgt
Substrate specificitySpecific to lipobox motifsSimilar specificityBroader specificity
Complementation abilityCan complement in E. coli systemsCan complement in E. coli systemsNot applicable
Catalytic residuesConserved H-bond networkConserved H-bond network (R155, R232, E236, R239)R143, R239, E243, R246
Substrate bindingContains conserved HGGL motifContains HGGL motif (residues 115-118)Similar motif present

Complementation studies demonstrate that H. pylori Lgt can functionally replace E. coli Lgt in conditional mutant strains, suggesting that despite sequence divergence, the fundamental enzymatic mechanism is conserved . Based on the close evolutionary relationship between H. acinonychis and H. pylori (sharing ~92% sequence identity), H. acinonychis Lgt likely possesses similar complementation capabilities, although this should be experimentally verified for the specific strain being studied .

How does the evolutionary history of H. acinonychis influence its Lgt properties?

H. acinonychis is closely related to H. pylori but has adapted to colonize the gastric mucosa of big cats rather than humans. Genetic analyses have identified two distinct groups of H. acinonychis strains with approximately 2% base substitution difference between groups and 8% difference from H. pylori strains . This evolutionary divergence may influence the structural and functional properties of H. acinonychis Lgt in several ways:

  • Host-specific adaptations may affect substrate preferences, as lipoprotein composition varies between species adapted to different hosts.

  • Despite genetic divergence, essential catalytic mechanisms are likely conserved, as indicated by the preservation of key functional residues across Helicobacter species.

  • The absence of certain virulence factors in H. acinonychis (such as the cag pathogenicity island) suggests potential differences in the regulation or repertoire of lipoproteins processed by Lgt in this species compared to H. pylori .

Understanding these evolutionary relationships can guide the design of experiments to investigate species-specific aspects of Lgt function and potentially illuminate mechanisms of host adaptation in Helicobacter species.

How can H. acinonychis Lgt be utilized to study bacterial lipoprotein biogenesis?

H. acinonychis Lgt provides a valuable model for studying bacterial lipoprotein biogenesis in the Epsilonproteobacteria class, which follows mechanisms distinct from the well-studied E. coli paradigm. Researchers can leverage this system through several approaches:

  • Comparative studies: Using purified recombinant H. acinonychis Lgt alongside Lgt from H. pylori and E. coli to identify species-specific variations in substrate preference, catalytic efficiency, and inhibitor sensitivity.

  • Mutagenesis experiments: Creating point mutations in conserved residues (e.g., the HGGL motif or the catalytic H-bond network) to determine their specific roles in substrate binding and catalysis .

  • Chimeric enzyme construction: Generating chimeric proteins between H. acinonychis Lgt and other bacterial Lgt enzymes to map functional domains important for species-specific properties.

  • Structural biology approaches: Pursuing crystallography or cryo-EM studies of H. acinonychis Lgt to determine its three-dimensional structure and provide insights into the catalytic mechanism.

  • In vivo tracking: Developing fluorescently tagged substrates to monitor lipoprotein processing in live cells expressing H. acinonychis Lgt.

These approaches can reveal unique aspects of lipoprotein processing in Helicobacter species compared to the canonical E. coli pathways .

What is the potential of H. acinonychis Lgt as an antimicrobial target?

H. acinonychis Lgt represents a promising antimicrobial target based on several key findings from related bacterial species:

  • Lgt depletion in a clinical uropathogenic E. coli strain leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics .

  • Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion, suggesting that Lgt inhibition may overcome common resistance mechanisms that invalidate inhibitors targeting downstream steps in bacterial lipoprotein biosynthesis .

  • Potent inhibitors of Lgt biochemical activity have been identified that show bactericidal activity against wild-type Acinetobacter baumannii and E. coli strains, with IC₅₀ values in the sub-micromolar range (0.18-0.93 μM) .

  • The essential nature of Lgt in many pathogenic bacteria makes it an attractive target, as evidenced by conditional mutant strains that cannot grow when Lgt expression is repressed .

Given the conservation of key catalytic residues between H. acinonychis Lgt and Lgt from other pathogenic bacteria, inhibitors developed against H. acinonychis Lgt might have broad-spectrum activity, though species-specific differences should be considered during drug development .

What challenges exist in developing high-throughput screening systems for H. acinonychis Lgt inhibitors?

Developing high-throughput screening (HTS) systems for H. acinonychis Lgt inhibitors presents several challenges:

  • Membrane protein solubility: As a membrane-associated enzyme, maintaining Lgt in a stable, active conformation outside its native environment requires careful optimization of detergent and lipid compositions.

  • Assay adaptation: The glycerol phosphate release assay needs optimization for HTS format, including signal-to-noise ratio improvement, minimization of false positives from compounds interfering with the luciferase-coupled detection system, and development of robust positive and negative controls.

  • Substrate preparation: Consistent preparation of suitable phosphatidylglycerol and peptide substrates at scale for HTS can be technically challenging and expensive.

  • Counterscreens: Development of appropriate counterscreens to eliminate non-specific inhibitors and compounds that interfere with the detection system rather than Lgt activity is essential.

  • Translation to cellular activity: Establishing a clear correlation between in vitro inhibition and cellular effects is crucial, as membrane permeability and efflux can significantly affect compound efficacy in bacterial cells.

Researchers have addressed some of these challenges by developing luminescence-based assays that can detect the glycerol phosphate byproduct of the Lgt reaction, which has enabled the identification of compounds with IC₅₀ values in the sub-micromolar range .

How can low activity of recombinant H. acinonychis Lgt be addressed?

Low activity of recombinant H. acinonychis Lgt can result from several factors, each requiring specific troubleshooting approaches:

  • Improper folding: Lower expression temperature (16-20°C), addition of folding enhancers like glycerol (10-15%) to growth media, and use of specialized E. coli strains designed for membrane proteins can improve proper folding.

  • Detergent selection: Screening multiple detergents (DDM, CHAPS, Triton X-100) at various concentrations to identify optimal solubilization conditions that maintain enzymatic activity.

  • Lipid requirements: Supplementation with specific phospholipids that might be required for structural integrity or activity, particularly phosphatidylglycerol, which serves as both a substrate and potential structural component.

  • Reducing environment: Ensuring consistent presence of reducing agents (DTT or β-mercaptoethanol) throughout purification to maintain the cysteine residues in their reduced state.

  • Metal ion dependence: Systematic testing of various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) that might be required for optimal activity.

  • Protein stability: Addressing potential proteolytic degradation by including protease inhibitors during purification and storage of the enzyme.

Implementing these strategies based on systematic troubleshooting can significantly improve the yield of active recombinant H. acinonychis Lgt .

What methods can verify the structural integrity of purified H. acinonychis Lgt?

Verifying the structural integrity of purified H. acinonychis Lgt is crucial for ensuring reliable experimental results. Several complementary techniques can be employed:

  • Circular dichroism (CD) spectroscopy: CD can assess secondary structure content and proper folding, providing information about the alpha-helical content expected for this membrane protein.

  • Thermal shift assays: These can evaluate protein stability under various buffer conditions and in the presence of ligands or inhibitors.

  • Limited proteolysis: Controlled digestion with proteases can reveal whether the protein exhibits a compact, well-folded structure resistant to proteolysis.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): This technique can determine if the protein exists as a monomer or in higher-order oligomeric states, which may affect its activity.

  • Activity correlation: Measuring enzymatic activity across different purification batches and correlating it with physical parameters can provide indirect evidence of structural integrity.

  • Western blot analysis with conformation-specific antibodies: If available, these can recognize properly folded epitopes and distinguish between native and denatured states.

These methods together provide a comprehensive assessment of protein quality before proceeding with detailed enzymatic characterization or inhibitor screening .

What are the most promising research directions for H. acinonychis Lgt studies?

Based on current knowledge, several promising research directions for H. acinonychis Lgt studies include:

  • Structural characterization: Determining the three-dimensional structure of H. acinonychis Lgt through X-ray crystallography or cryo-EM would provide invaluable insights into its catalytic mechanism and facilitate structure-based inhibitor design.

  • Species-specific inhibitor development: Identifying compounds that selectively inhibit Lgt from Helicobacter species could lead to targeted antimicrobial strategies with reduced impact on beneficial gut microbiota.

  • Comparative genomics and evolution: Further exploring the evolutionary relationship between H. acinonychis and H. pylori Lgt could reveal adaptation mechanisms relevant to host specificity and pathogenicity.

  • In vivo function: Investigating the specific roles of lipoproteins processed by Lgt in H. acinonychis pathogenesis and host adaptation could illuminate virulence mechanisms.

  • Combination therapies: Exploring synergistic effects between Lgt inhibitors and conventional antibiotics could lead to more effective treatment strategies for resistant bacterial infections.

These research directions could significantly advance our understanding of bacterial lipoprotein biosynthesis across species and potentially lead to novel therapeutic approaches .

What ethical considerations apply to H. acinonychis research?

Research involving H. acinonychis carries specific ethical considerations:

  • Conservation implications: As H. acinonychis is found in endangered big cats like cheetahs, research should be conducted with sensitivity to conservation concerns, prioritizing recombinant techniques over direct isolation when possible.

  • Biosafety protocols: Though H. acinonychis is not known to infect humans, proper biosafety measures should be maintained given its close relationship to the human pathogen H. pylori.

  • Responsible resource sharing: Researchers should contribute to public databases and repositories to advance collective knowledge while adhering to material transfer agreements and intellectual property considerations.

  • Animal research guidelines: Any research involving animal models must adhere to institutional animal care and use committee (IACUC) guidelines, with particular attention to the 3Rs principle (replacement, reduction, refinement).

  • Applications in wildlife medicine: Potential applications of H. acinonychis research in treating bacterial infections in captive big cats should be developed with veterinary input and conservation priorities in mind.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.