Recombinant Helicobacter acinonychis Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; Hac_1601; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Helicobacter acinonychis (strain Sheeba)
Target Names
crcB
Target Protein Sequence
MNLVFLWAALGGALGSSLRYFVGKMMPSKFLMFESFPLGTFSVNLIGCFVIGLMGHLAAK KVFGDDFGIFFVTGVLGGFTTFSSYGLDTLKLLQKSQYIEAISYVLGTNILGLIGVAIGW FLAKNFV
Uniprot No.

Target Background

Function

Crucial in reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Helicobacter acinonychis and how does it relate to other Helicobacter species?

Helicobacter acinonychis (formerly H. acinonyx) is a bacterial species closely related to the human gastric pathogen Helicobacter pylori. Phylogenetic analysis has identified two main groups within H. acinonychis isolates. Group I includes isolates from cheetahs and some lions, while Group II contains isolates from tigers and lion-tiger hybrids . Genetic studies reveal approximately 2% base substitution difference between these two H. acinonychis groups and approximately 8% difference between these genes and their homologs in H. pylori reference strains . Unlike H. pylori, H. acinonychis lacks the cag pathogenicity island and contains a degenerate vacuolating cytotoxin (vacA) gene . These genetic characteristics make H. acinonychis an valuable model for studying Helicobacter evolution and host adaptation.

What functions does the CrcB homolog protein serve in Helicobacter species?

While the search results don't specifically address the CrcB homolog in H. acinonychis, CrcB homologs in bacteria typically function as membrane proteins involved in ion transport, particularly fluoride ion export, which provides resistance to environmental toxins. In the context of Helicobacter species, these proteins may contribute to bacterial survival in hostile environments such as the acidic stomach. The protein's role should be examined through targeted gene knockout studies and functional complementation assays to definitively establish its role in H. acinonychis biology.

How are recombinant H. acinonychis proteins typically expressed and purified for research purposes?

Recombinant H. acinonychis proteins, including CrcB homolog, are typically expressed in laboratory bacterial systems such as E. coli. The gene encoding the target protein is amplified using PCR with gene-specific primers and cloned into an appropriate expression vector. Expression systems often include affinity tags (His, GST, etc.) to facilitate purification. The recombinant protein is then expressed under optimized conditions, extracted, and purified using affinity chromatography followed by size exclusion or ion exchange chromatography for higher purity. Quality control involves SDS-PAGE and Western blotting to confirm protein identity and purity. For membrane proteins like CrcB homologs, specialized detergent-based extraction methods may be necessary to maintain protein structure and function.

What are the optimal conditions for expressing and solubilizing recombinant H. acinonychis CrcB homolog protein?

The expression and solubilization of recombinant H. acinonychis CrcB homolog protein requires optimization due to its likely membrane-associated nature. Based on approaches used for similar bacterial proteins, researchers should consider:

  • Expression systems: BL21(DE3) E. coli strains with specialized vectors for membrane proteins

  • Induction parameters: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM)

  • Solubilization agents: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

  • Stabilizing additives: Glycerol (10-20%) and specific ion concentrations based on the protein's native environment

The purification protocol should be validated through activity assays to ensure the recombinant protein maintains its native conformation and function. Western blot analysis using antibodies specific to the CrcB homolog or attached affinity tags should be employed to confirm protein identity.

How can mouse models be established for studying H. acinonychis CrcB homolog protein function in vivo?

H. acinonychis derivatives capable of chronically infecting mice have been successfully established through selective adaptation . For studying the CrcB homolog protein specifically:

  • Generate H. acinonychis strains with modified CrcB homolog genes (knockout, point mutations, or overexpression)

  • Select derivatives that can colonize mice through serial passage

  • Confirm stable colonization through bacterial recovery from gastric tissue

  • Compare colonization efficiency between wild-type and modified strains

  • Analyze host responses through histopathology, immunological markers, and transcriptomics

Research has demonstrated that H. acinonychis can establish persistent mixed infection with certain H. pylori strains in mice . This creates opportunities for studying gene transfer and recombination involving the CrcB homolog gene, which could provide insights into bacterial adaptation mechanisms.

What analytical techniques are most effective for characterizing protein-protein interactions involving the CrcB homolog?

For characterizing protein-protein interactions involving the H. acinonychis CrcB homolog:

  • Co-immunoprecipitation (Co-IP) with antibodies against CrcB homolog or potential interacting partners

  • Bacterial two-hybrid or yeast two-hybrid screening to identify novel interacting proteins

  • Surface plasmon resonance (SPR) for quantitative binding affinity measurements

  • Crosslinking mass spectrometry to identify interaction sites

  • Fluorescence resonance energy transfer (FRET) for studying interactions in living cells

These techniques can be complemented with computational approaches such as molecular docking and protein-protein interaction network analysis to generate testable hypotheses about the functional role of CrcB in bacterial physiology and pathogenesis.

How does the CrcB homolog from H. acinonychis compare to similar proteins in H. pylori and other Helicobacter species?

Based on the genetic relationships between Helicobacter species, we would expect approximately 8% sequence divergence between the CrcB homolog in H. acinonychis and H. pylori . A comparative analysis should include:

  • Multiple sequence alignment of CrcB homologs across Helicobacter species

  • Phylogenetic tree construction to visualize evolutionary relationships

  • Identification of conserved domains and variable regions

  • Structural modeling to predict functional implications of sequence variations

This comparative approach can reveal adaptations specific to H. acinonychis and potentially correlate protein sequence variations with host specificity or environmental adaptations.

What role might the CrcB homolog play in H. acinonychis adaptation to different host species?

H. acinonychis has been isolated from various big cats including cheetahs, lions, tigers, and lion-tiger hybrids . The protein may contribute to host adaptation through:

  • Membrane composition modifications for survival in different gastric environments

  • Ion transport regulation in response to host-specific pH or ionic conditions

  • Potential interactions with host immune components

Experimental approaches to investigate this should include:

  • Comparative genomic analysis of CrcB homologs from H. acinonychis strains isolated from different host species

  • Expression analysis under conditions mimicking different host environments

  • Competitive colonization assays in animal models using wildtype and CrcB-modified strains

How might studying the CrcB homolog contribute to understanding Helicobacter pathogenesis mechanisms?

The study of CrcB homolog in H. acinonychis could provide valuable insights into Helicobacter pathogenesis through:

  • Understanding bacterial adaptation mechanisms during host jumps (from big cats to other mammals)

  • Elucidating the role of membrane proteins in colonization and persistence

  • Identifying potential therapeutic targets for treating Helicobacter infections

H. pylori infection is associated with gastric cancer and has been linked to colorectal cancer risk in some populations, particularly in African Americans . Understanding the function of conserved proteins across Helicobacter species could illuminate mechanisms of pathogenesis relevant to human disease.

What experimental approaches can distinguish the functions of CrcB homolog in different H. acinonychis strains?

Given the identification of two distinct groups of H. acinonychis with approximately 2% genetic difference , investigating CrcB homolog functions across these strains requires:

  • Comparative sequence analysis of the CrcB gene from both Group I and Group II strains

  • Generation of recombinant proteins from representatives of each group

  • Functional assays measuring ion transport, membrane integrity, or other relevant activities

  • Complementation experiments in CrcB-knockout strains from each group

  • Transcriptomic analysis to identify differences in gene expression networks associated with CrcB

Experimental ApproachGroup I StrainsGroup II StrainsExpected Outcome
Gene sequence analysisCheetah and lion isolatesTiger and lion-tiger hybrid isolatesIdentification of strain-specific variations
Protein expressionRecombinant expression in E. coliRecombinant expression in E. coliPurified proteins for functional comparison
Membrane localizationFluorescently tagged proteinFluorescently tagged proteinVerification of subcellular localization
Knockout phenotypeGrowth, stress resistance, colonization abilityGrowth, stress resistance, colonization abilityFunctional impact assessment
ComplementationCross-complementation between groupsCross-complementation between groupsFunctional conservation evaluation

What are the main challenges in producing functional recombinant CrcB homolog and how can they be addressed?

Membrane proteins like CrcB homologs present specific challenges in recombinant production:

  • Challenge: Protein misfolding and aggregation
    Solution: Use specialized expression strains (C41/C43), lower expression temperatures (16-20°C), and fusion tags that enhance solubility (MBP, SUMO)

  • Challenge: Low expression yields
    Solution: Optimize codon usage for the expression host, use strong inducible promoters with fine-tuned induction conditions

  • Challenge: Maintaining native conformation during purification
    Solution: Screen detergent panels for optimal extraction, use lipid nanodiscs or amphipols for stabilization

  • Challenge: Functional validation
    Solution: Develop specific activity assays based on predicted ion transport functions, use liposome reconstitution to measure transport activities

How can researchers validate the specificity of antibodies developed against H. acinonychis CrcB homolog?

Antibody validation is critical for reliable experimental results when studying the CrcB homolog:

  • Western blot against recombinant protein: Use purified recombinant CrcB homolog as a positive control

  • Knockout controls: Test antibody against lysates from CrcB knockout strains to confirm specificity

  • Cross-reactivity assessment: Test against related Helicobacter species to determine cross-reactivity

  • Immunoprecipitation validation: Verify ability to pull down the native protein from bacterial lysates

  • Immunofluorescence microscopy: Confirm expected subcellular localization patterns

  • Epitope mapping: Identify the specific regions recognized by the antibody

How might coinfection models with H. acinonychis and H. pylori provide insights into CrcB homolog evolution?

Studies have demonstrated that H. acinonychis can establish persistent mixed infections with certain H. pylori strains in mice, and several variants due to recombination or new mutations were found after two months of mixed infection . This creates an excellent model for studying protein evolution:

  • Track genetic exchange and recombination events involving the CrcB homolog

  • Identify selective pressures that drive CrcB evolution during coinfection

  • Compare expression patterns of CrcB between the species during mixed infection

  • Assess functional adaptations that might emerge through horizontal gene transfer

These approaches could provide insight into how membrane proteins like CrcB evolve during bacterial adaptation to new hosts or environmental niches.

What potential roles might the CrcB homolog play in bacterial resistance to host defense mechanisms?

As a membrane protein potentially involved in ion homeostasis, the CrcB homolog may contribute to bacterial survival against host defenses through:

  • Resistance to antimicrobial peptides by maintaining membrane integrity

  • pH adaptation in the acidic gastric environment

  • Resistance to metal ion toxicity as part of the host nutritional immunity

  • Potential involvement in biofilm formation for collective protection

Research methodologies to investigate these roles should include:

  • Gene expression analysis under host-mimicking stress conditions

  • Susceptibility testing of wildtype versus CrcB-modified strains to various host defense components

  • Structural studies to identify potential interaction sites with host factors

  • Comparative analysis of CrcB homologs across Helicobacter species with different host ranges

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.