Recombinant Helicobacter hepaticus Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant H. hepaticus Lnt is produced in E. coli expression systems and purified for research applications. Key specifications include:

PropertyDetailsSource
SpeciesHelicobacter hepaticus (strain ATCC 51449 / 3B1)
Uniprot IDQ7VFP7
Protein LengthFull-length (1–400 amino acids)
TagUndisclosed (determined during production)
Purity>90% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C
ApplicationsEnzyme assays, structural studies, lipoprotein biosynthesis research

The amino acid sequence of H. hepaticus Lnt includes conserved catalytic residues (e.g., E267, K335, C387 in E. coli homologs) critical for acyltransferase activity .

2.1. Catalytic Mechanism

Lnt adopts an eight-transmembrane helix fold with a lipid-binding groove and catalytic triad (E242, K296, C349 in H. pylori Lnt) . The enzyme binds phosphatidylethanolamine (POPE) as an acyl donor, forming an acyl-enzyme intermediate before transferring the acyl group to apolipoproteins . Mutagenesis studies in E. coli Lnt reveal that residues F146, W148, and F416 are essential for lipid binding and enzymatic activity .

2.2. Role in Bacterial Physiology

  • Essentiality: In E. coli, Lnt is indispensable for viability and outer membrane integrity . Depletion causes periplasmic swelling, increased membrane permeability, and susceptibility to vancomycin .

  • Virulence: H. hepaticus Lnt homologs in H. pylori are critical for colonization in murine models. Δlnt mutants fail to colonize due to altered Toll-like receptor 2 (TLR2) signaling triggered by diacylated lipoproteins .

Comparative Analysis Across Species

FeatureE. coli LntH. pylori LntH. hepaticus Lnt
EssentialityEssential for growth Non-essential in vitro Undetermined
TLR2 ActivationTriacylated lipoproteins Δlnt mutants enhance TLR2 response Likely similar to H. pylori
Structural Fold8-TM helices Homologous to E. coli Predicted similar

Research Applications

  • Enzymatic Assays: Used to study lipid transfer kinetics using synthetic diacylated peptides (e.g., Pam2Cys-SSNKNGGK-Biotin) and POPE micelles .

  • Therapeutic Targeting: Lnt inhibition disrupts lipoprotein maturation, offering a strategy against Gram-negative pathogens .

Outstanding Questions

  • Does H. hepaticus Lnt share the same essentiality profile as H. pylori or E. coli?

  • How do structural variations between species impact substrate specificity?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
lnt; HH_1628; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Species
Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Target Names
lnt
Target Protein Sequence
MLPFYAQWVLESYDKAISPLLVSLLGLFSIASVLFVPKNRRFGVGFFIGMLWFYWISLGL RYFDMSFLIPLVVIACGIFMGFVFYIGLWCECLIVRFAFLLLLSYLTPFGFDWIVPESVF AYSYIGVDKLSFALSILALWILFKYKTWWKLGGVICLVFALDFGLKDSKIQNLPPLKIKL AQSAVSQDFDYRMREAKSIFSEHISDIQKAINEEYDVIILPESAFYVPLDSQYFPYFDSL LEMSHKIVIIVGALREEIHTDGRASYFNSTYKFDKGKVSFYDKVHLVPFGETLPSFLLPL VNTFFQGIGGFSAGKDFGYFDIAEIKFKNAICYEGSNRGFYADYPQYVIVTSNNAWFVPS IEPILQKNLMKYYARLYGSVIFHATNLSPAAIITPFVSSR
Uniprot No.

Target Background

Function
Recombinant Helicobacter hepaticus Apolipoprotein N-acyltransferase (lnt) catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein. This enzyme plays a crucial role in the final step of lipoprotein maturation.
Database Links

KEGG: hhe:HH_1628

STRING: 235279.HH1628

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) and what is its function in Helicobacter species?

Apolipoprotein N-acyltransferase (lnt) is an enzyme involved in the third step of lipoprotein synthesis in Gram-negative bacteria, including Helicobacter pylori. In the lipoprotein synthesis pathway, after Prolipoprotein diacylglyceryl transferase (Lgt) adds a diacylglyceride to the sulfhydryl group of the cysteine residue and Prolipoprotein signal peptidase (LspA) removes the signal peptide, lnt adds a third acyl chain to the terminal amine of the acylated cysteine residue. This results in a mature, triacylated lipoprotein . The triacylation of lipoproteins by lnt plays a crucial role in the proper functioning of the bacterial outer membrane and influences host-pathogen interactions through Toll-like receptor (TLR) signaling pathways .

What are the standard methods for generating lnt mutant strains in Helicobacter?

To generate lnt mutant strains in Helicobacter pylori, researchers typically employ a targeted gene replacement strategy. Based on the search results, the standard methodology involves:

  • Constructing a recombinant strain where the lnt promoter and open reading frame are replaced by a selectable marker (e.g., aphA3, conferring kanamycin resistance)

  • Ensuring the expression of downstream genes within the operon by inserting a copy of the lnt promoter downstream of the selectable marker

  • Transforming the parent strain (e.g., H. pylori J166) with this construct

  • Selecting for antibiotic-resistant colonies (e.g., kanamycin-resistant)

For complementation studies, the mutant strain can be transformed with a plasmid containing the lnt gene under the control of a constitutive promoter (such as the ureA promoter), with selection using a different antibiotic resistance marker (e.g., chloramphenicol resistance) . The plasmid is designed to integrate into a neutral chromosomal locus (such as the hydA-mdaB intergenic region) .

How can researchers confirm successful deletion and complementation of lnt in Helicobacter species?

Successful deletion and complementation of lnt in Helicobacter can be confirmed through multiple complementary approaches:

  • Quantitative Real-Time PCR (qRT-PCR): This method allows researchers to confirm the loss of lnt expression in mutant strains and restoration of expression in complemented strains by measuring mRNA levels. In the studies referenced, qRT-PCR analysis confirmed the absence of lnt expression in strain VM391 (Δlnt mutant) and restoration of expression in strain VM392 (complemented mutant) .

  • Phenotypic Characterization: Comparing growth characteristics and stress responses between wild-type, mutant, and complemented strains. In H. pylori, deletion of lnt did not negatively impact bacterial growth rate or sensitivity to pH and antibiotics that typically do not cross the Gram-negative outer membrane (such as vancomycin and bacitracin) .

  • Lipoprotein Acylation Analysis: Confirmation of altered lipoprotein acylation status (diacylated vs. triacylated) can be performed by purifying a model lipoprotein (such as Lpp20) from wild-type and mutant strains, followed by mass spectrometry analysis to determine the number of acyl chains present .

What cell culture and reporter systems are appropriate for studying lnt function in host-pathogen interactions?

Based on the search results, several cell culture and reporter systems have proven effective for studying lnt function in host-pathogen interactions:

  • TLR Reporter Cell Lines: Human embryonic kidney (HEK) reporter cell lines engineered to express different TLR combinations (TLR4, TLR2+TLR1, TLR2+TLR6, or TLR2 alone) are valuable for investigating how lipoproteins from wild-type or lnt mutant bacteria differentially activate TLR signaling. These systems typically measure secreted alkaline phosphatase as a reporter for TLR activation .

  • Primary Human Gastric Epithelial Cells: These cells provide a physiologically relevant model for studying the host response to Helicobacter lipoproteins. Differential gene expression analysis can be performed after treating these cells with purified lipoproteins from wild-type or lnt mutant bacteria to assess the impact on TLR2 signaling and downstream gene expression .

  • Control Systems: Appropriate controls include HEK null cells expressing no TLR transgene, which help distinguish between TLR-dependent and TLR-independent responses to bacterial lipoproteins .

These systems have revealed that diacylated lipoproteins from lnt mutant H. pylori preferentially stimulate TLR2-TLR6 expressing cells, while triacylated lipoproteins from wild-type bacteria interact with both TLR2-TLR1 and TLR2-TLR6 heterodimers, with different signaling outcomes .

What animal models are suitable for investigating lnt function in colonization and pathogenesis?

Mouse models have proven valuable for investigating the role of lnt in Helicobacter colonization and pathogenesis. Based on the search results, researchers have utilized:

  • Wild-type mice: Standard laboratory mice can be used to assess the colonization capacity of wild-type, lnt mutant, and complemented Helicobacter strains. Studies have shown that while wild-type and complemented H. pylori successfully colonize wild-type mice, lnt mutant strains fail to establish colonization, highlighting the essential role of lnt in vivo despite being dispensable for in vitro growth .

  • Tlr2-/- mice: Mice lacking Toll-like receptor 2 are particularly useful for investigating whether the colonization defect of lnt mutants is mediated through TLR2 signaling. Interestingly, lnt mutant H. pylori failed to colonize both wild-type and Tlr2-/- mice, suggesting that the colonization defect is not primarily due to enhanced TLR2-mediated immune responses .

When designing animal experiments, researchers should consider:

  • Appropriate sample sizes for statistical power

  • Duration of infection (H. pylori can persist for decades in humans)

  • Analysis of bacterial burden in different stomach regions

  • Assessment of inflammatory responses

  • Ethical considerations and animal welfare regulations

How does the acylation state of lipoproteins affect the immune response to Helicobacter infection?

The acylation state of lipoproteins significantly impacts the host immune response to Helicobacter infection through differential activation of Toll-like receptor pathways. Research has revealed several key aspects of this relationship:

  • Differential TLR Activation: Diacylated lipoproteins (from lnt mutant bacteria) preferentially stimulate TLR2-TLR6 heterodimers, while triacylated lipoproteins (from wild-type bacteria) can activate both TLR2-TLR1 and TLR2-TLR6 complexes . This differential receptor engagement leads to distinct downstream signaling patterns.

  • Enhanced Immune Response to Diacylated Lipoproteins: Experiments with purified Lpp20 lipoprotein from wild-type and lnt mutant H. pylori showed that diacylated lipoprotein from the lnt mutant induced a more robust TLR2 response in both reporter cell lines and primary human gastric epithelial cells . Differential gene expression analysis confirmed this heightened response at the transcriptional level.

  • Colonization Failure Despite Immunomodulation: Despite the expectation that enhanced TLR2 activation would be the primary cause of colonization failure for lnt mutants, these mutants failed to colonize both wild-type and Tlr2-/- mice . This suggests that the essential role of lnt in colonization extends beyond simply modulating the TLR2-mediated immune response and may involve additional functions critical for bacterial adaptation to the gastric environment.

These findings indicate that proper lipoprotein acylation by lnt helps H. pylori modulate the host immune response to facilitate persistent colonization, possibly representing an evolved immune evasion strategy.

What are the observed physiological consequences of lnt deletion in Helicobacter compared to other Gram-negative bacteria?

The physiological consequences of lnt deletion in Helicobacter pylori show notable differences compared to other Gram-negative bacteria:

Bacterial SpeciesGrowth ImpactMembrane IntegrityAntibiotic SensitivityColonization Ability
H. pyloriNo change in growth rate No apparent defectsNo increased sensitivity to vancomycin or bacitracin Unable to colonize mouse models
E. coli & Salmonellalnt is essential N/AN/AN/A
Francisella, Neisseria, AcinetobacterVariable, from minimal to severe defects Often perturbedOften increased sensitivity to antibiotics Variable

The underlying mechanisms for these species-specific differences remain to be fully elucidated but may involve differences in outer membrane composition, alternative acylation pathways, or unique adaptations to ecological niches.

How might lnt be leveraged as a therapeutic target for Helicobacter infections?

The research findings suggest several promising approaches for leveraging lnt as a therapeutic target for Helicobacter infections:

  • Small Molecule Inhibitors: Developing specific inhibitors targeting lnt enzymatic activity could potentially prevent H. pylori colonization without affecting bacterial viability in vitro, potentially reducing selection pressure for resistance . This approach would target the essential role of lnt in the host environment while avoiding the challenges associated with targeting essential growth factors.

  • Attenuation for Vaccine Development: Since lnt mutants can grow in vitro but fail to colonize in vivo, they represent potential candidates for live attenuated vaccine strains. These strains could potentially induce protective immunity without establishing persistent infection .

  • Adjuvant Properties of Diacylated Lipoproteins: The enhanced TLR2 activation by diacylated lipoproteins from lnt mutants could be exploited to develop more potent adjuvants for vaccines against H. pylori or other pathogens .

  • Combination Therapies: Inhibitors of lnt could potentially be combined with traditional antibiotics to enhance clearance of H. pylori infections, particularly in cases of antibiotic resistance .

The fact that lnt deletion has minimal impact on H. pylori growth in vitro but completely prevents colonization makes it a particularly attractive therapeutic target, as compounds targeting lnt function may have a high therapeutic index with minimal effects on beneficial components of the gut microbiome.

What are the challenges in purifying and analyzing lipoproteins from Helicobacter species?

Purifying and analyzing lipoproteins from Helicobacter species presents several technical challenges:

  • Low Abundance: Some lipoproteins may be expressed at low levels, making their purification challenging. Researchers have addressed this by selecting abundant lipoproteins like Lpp20 as model proteins for analysis, as indicated by previous proteomic studies .

  • Tagging Strategies: To facilitate purification, researchers have employed epitope tagging approaches, such as adding human influenza hemagglutinin (HA) tags to lipoproteins of interest. This strategy was used successfully to purify Lpp20-HA from both wild-type and lnt mutant H. pylori strains .

  • Maintaining Lipid Modifications: During purification, maintaining the native lipid modifications is crucial for meaningful functional studies. This requires careful optimization of detergent conditions and purification protocols to preserve the acylation state of the lipoproteins.

  • Analytical Techniques: Distinguishing between diacylated and triacylated lipoproteins requires sophisticated analytical techniques such as mass spectrometry, which can be technically demanding and require specialized equipment.

To overcome these challenges, researchers have developed recombinant strains expressing tagged lipoproteins (e.g., VM396 expressing HA-tagged Lpp20 in wild-type background and VM404 in lnt mutant background) , enabling affinity purification and subsequent functional and structural analyses.

How can researchers effectively analyze the impact of lnt deletion on global gene expression in host cells?

Effectively analyzing the impact of lnt deletion on global gene expression in host cells requires a comprehensive approach:

  • Experimental Design: Researchers should expose relevant host cells (such as primary human gastric epithelial cells) to purified lipoproteins from wild-type and lnt mutant bacteria under controlled conditions. Time-course experiments may reveal different phases of the response .

  • RNA Extraction and Quality Control: High-quality RNA extraction from host cells followed by rigorous quality control is essential for reliable gene expression analysis.

  • Transcriptomic Analysis Methods:

    • RNA sequencing (RNA-seq) provides comprehensive coverage of the transcriptome

    • Microarray analysis may be suitable for well-characterized systems

    • Validation of key findings with qRT-PCR for selected genes

  • Bioinformatic Analysis:

    • Differential expression analysis to identify genes significantly affected by exposure to diacylated versus triacylated lipoproteins

    • Pathway enrichment analysis to identify biological processes and signaling pathways affected

    • Regulatory network analysis to identify key transcription factors driving the differential response

  • Validation Studies:

    • Protein-level validation of key findings (Western blot, ELISA)

    • Functional assays to assess the biological significance of identified pathways

    • Cytokine profiling to characterize the inflammatory response

The search results indicate that differential gene expression analysis revealed that lipoprotein from the lnt mutant induced a more robust TLR2 response compared to wild-type lipoprotein , demonstrating the utility of this approach in characterizing host responses to differently acylated lipoproteins.

How do we reconcile the in vitro versus in vivo phenotypes of lnt mutants in Helicobacter species?

One of the most intriguing aspects of Helicobacter lnt research is the striking disconnect between in vitro and in vivo phenotypes of lnt mutants. This apparent contradiction requires careful analysis:

This contradiction highlights the limitations of standard laboratory testing in predicting in vivo behavior and underscores the complex adaptations required for successful host colonization.

What are the current gaps in understanding the structural and functional consequences of lipoprotein acylation in Helicobacter?

Despite significant advances, several important gaps remain in our understanding of lipoprotein acylation in Helicobacter:

Addressing these gaps will require interdisciplinary approaches combining structural biology, biochemistry, microbiology, immunology, and in vivo infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.