Recombinant Helicobacter hepaticus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; HH_1497; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Target Names
atpB
Target Protein Sequence
MDERLFTFAGLINPNHDFIIGFHTLLVAVILLILARYATHKMQVVPSGIQNVFEFIISGI ISFAKDIVGEQVARKYFPLAATIAFLVFFGNAIGIIPGFEAPTSSWSFTLVLALVVFFYY HFEGIRAQGVLKYFKHFMGPVWWLAPLMFPVEIISHFSRIISLSFRLFGNIKGDDMFLLV MLMLAPWIVPVAPFAILTFMALLQAFVFMILTYVYIHGAVVVDEEH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: hhe:HH_1497

STRING: 235279.HH1497

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Helicobacter hepaticus ATP synthase subunit a (atpB) and what is its biological significance?

Helicobacter hepaticus ATP synthase subunit a (atpB) is a critical membrane protein component of the F0 sector of ATP synthase complex. This 226-amino acid protein (UniProt ID: Q7VG27) plays an essential role in the energy metabolism of H. hepaticus by facilitating proton translocation across the bacterial membrane during oxidative phosphorylation . H. hepaticus is the prototype of human enterohepatic helicobacters and is associated with inflammatory conditions including colitis and hepatobiliary tumors in susceptible animal models . Unlike H. pylori which primarily colonizes the gastric environment, H. hepaticus inhabits the liver and intestinal tract, making its ATP synthase particularly interesting for comparative studies of bacterial adaptation to different host microenvironments .

How is recombinant H. hepaticus atpB protein produced for research applications?

Recombinant H. hepaticus atpB is typically produced using E. coli expression systems. The production process involves:

  • Cloning the full-length atpB gene (1-226 amino acids) into an appropriate expression vector

  • Adding an N-terminal His-tag for purification purposes

  • Transforming the construct into E. coli

  • Inducing protein expression under optimized conditions

  • Lysing the bacterial cells

  • Purifying the His-tagged protein using affinity chromatography

  • Quality control testing, including SDS-PAGE to confirm purity (typically >90%)

  • Lyophilization to produce a stable powder form

This standardized approach enables researchers to obtain purified protein suitable for various experimental applications, including structural studies, enzymatic assays, and antibody production.

How does H. hepaticus atpB differ from H. pylori atpB, and what are the research implications?

Comparative analysis reveals both similarities and differences between the atpB proteins of these two Helicobacter species:

While both proteins share the same core function in ATP synthesis, the observed sequence variations likely reflect adaptations to their distinct ecological niches—H. pylori in the acidic gastric environment versus H. hepaticus in the liver and intestinal tract . These differences can be exploited for developing species-specific diagnostic tools and targeted therapeutics. Furthermore, understanding these structural variations provides insights into how these pathogens have evolved to inhabit different microenvironments within the human body.

What role might H. hepaticus atpB play in bacterial pathogenesis and disease?

H. hepaticus has been associated with hepatobiliary disorders and inflammatory bowel diseases in animal models. Recent research suggests several mechanisms by which atpB might contribute to pathogenesis:

  • Energy provision for virulence: As a core component of ATP synthase, atpB enables the bacterium to generate energy required for colonization, replication, and expression of virulence factors.

  • Adaptation to microenvironments: The specialized structure of H. hepaticus atpB may facilitate bacterial survival in the hepatobiliary system, where conditions differ significantly from the gastric environment inhabited by H. pylori.

  • Immune system interactions: Recent studies suggest that certain bacterial ATP synthase components can be recognized by the host immune system, potentially contributing to inflammatory responses. Seropositivity to various H. hepaticus antigens has been associated with increased risk of hepatobiliary cancers, indicating a potential role in carcinogenesis .

  • Metabolic flexibility: The atpB protein may contribute to the ability of H. hepaticus to adapt to changing nutrient conditions within the host, enhancing its persistence in chronic infections .

What experimental evidence links H. hepaticus to cancer development?

A significant body of research has investigated the relationship between H. hepaticus infection and cancer development. A recent study examined this association in two major cohorts: the Finnish Alpha-Tocopherol, Beta-Carotene Cancer Prevention (ATBC) Study and the US-based Prostate, Lung, Colorectal, and Ovarian Cancer Screening Trial (PLCO) .

The study found that seropositivity to specific H. hepaticus antigens was associated with increased risk of hepatobiliary cancers in the PLCO cohort:

  • Seropositivity to H. hepaticus antigen HH0407 was associated with a significantly higher risk of biliary cancer (OR: 5.01; 95% CI: 1.53, 16.40)

  • Seropositivity to H. hepaticus antigen HH1201 also showed increased risk of biliary cancer (OR: 2.40; 95% CI: 1.00, 5.76)

  • The H. bilis antigen HRAG 01470 similarly showed association with biliary cancer (OR: 3.27; 95% CI: 1.14, 9.34)

Interestingly, no significant associations were observed in the ATBC cohort, suggesting potential geographical or population-specific variations in the relationship between Helicobacter infection and cancer development. These findings highlight the complex interplay between bacterial factors, host genetics, and environmental influences in carcinogenesis .

What are the optimal storage and handling conditions for recombinant H. hepaticus atpB?

For optimal stability and activity of recombinant H. hepaticus atpB, researchers should follow these evidence-based guidelines:

  • Long-term storage:

    • Store at -20°C/-80°C upon receipt

    • Aliquot the protein to avoid repeated freeze-thaw cycles

    • Add glycerol to a final concentration of 5-50% (50% is standard)

  • Buffer conditions:

    • Maintain in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • For working concentrations, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Handling procedures:

    • Briefly centrifuge vials before opening to bring contents to the bottom

    • For short-term use, store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

These storage conditions have been optimized to maintain the structural integrity and functional activity of the protein, ensuring reliable experimental results.

How can researchers assess the functional activity of recombinant H. hepaticus atpB?

Several methodological approaches can be employed to evaluate the functional activity of recombinant H. hepaticus atpB:

  • ATP synthesis assays: Reconstitute the purified atpB into proteoliposomes with other ATP synthase subunits and measure ATP production using luciferase-based luminescence assays under defined proton gradient conditions.

  • Proton translocation studies: Utilize pH-sensitive fluorescent dyes (such as ACMA or pyranine) to monitor proton movement across membranes containing reconstituted ATP synthase complexes.

  • ATPase activity measurements: Although atpB is part of the proton-conducting F0 portion, the assembled complex exhibits ATP hydrolysis activity that can be measured via colorimetric detection of inorganic phosphate release.

  • Membrane potential measurements: Using voltage-sensitive dyes to assess how atpB incorporation affects membrane potential in artificial membrane systems.

  • Structural integrity assessment: Circular dichroism spectroscopy to confirm proper protein folding, particularly important for membrane proteins like atpB.

These functional assays should be complemented with controls using known ATP synthase inhibitors to validate specificity of the observed activities.

What strategies can be employed for generating specific antibodies against H. hepaticus atpB?

Developing specific antibodies against H. hepaticus atpB requires careful consideration of several factors:

  • Epitope selection: Analyze the sequence to identify regions that:

    • Are unique to H. hepaticus (to avoid cross-reactivity with H. pylori or host proteins)

    • Have high predicted antigenicity

    • Are likely to be surface-exposed in the native protein

  • Immunization strategies:

    • Use full-length recombinant His-tagged protein for polyclonal antibody production

    • For monoclonal antibodies, consider synthetic peptides corresponding to specific epitopes

    • Employ DNA immunization with the atpB gene for complex conformational epitopes

  • Purification approaches:

    • Affinity purification using immobilized recombinant protein

    • Cross-adsorption with related proteins to enhance specificity

    • Epitope-specific purification for targeting defined regions

  • Validation methods:

    • Western blotting against recombinant protein and native bacterial lysates

    • Immunoprecipitation to confirm recognition of the native protein

    • Immunofluorescence microscopy to verify cellular localization

    • ELISA to determine sensitivity and specificity thresholds

By carefully selecting immunogens and employing rigorous validation, researchers can develop antibodies that specifically recognize H. hepaticus atpB with minimal cross-reactivity to related proteins.

What experimental models are most appropriate for studying H. hepaticus atpB in disease contexts?

Based on current literature, several experimental models have proven valuable for investigating the role of H. hepaticus and its components in disease pathogenesis:

  • IL-10 deficient mouse model: B6.129P2-IL10tm1Cgn/J mice infected with H. hepaticus develop colitis, making them an excellent model for inflammatory bowel disease studies. This model can be used to evaluate how mutations or modifications in atpB affect bacterial colonization and disease progression .

  • Germ-free mouse models: These provide a controlled environment for studying H. hepaticus colonization without interference from other microbiota. Interestingly, some studies indicate that H. hepaticus requires co-infection with other bacteria (such as Lactobacillus reuteri) to induce typical colonic inflammation in germ-free mice .

  • Cell culture systems: Human and murine hepatic and intestinal epithelial cell lines can be used to study direct interactions between the bacterium or purified atpB and host cells.

  • Ex vivo tissue models: Precision-cut liver slices or intestinal organoids offer advantages of maintaining tissue architecture while allowing controlled experimental manipulation.

  • Comparative studies: Using wild-type versus atpB mutant strains to assess the specific contribution of this protein to colonization, persistence, and disease induction .

These models provide complementary approaches for investigating different aspects of H. hepaticus pathogenesis and the specific role of atpB in these processes.

How might structural studies of H. hepaticus atpB inform drug development?

Structural characterization of H. hepaticus atpB presents several opportunities for therapeutic development:

  • Identification of species-specific binding pockets: Detailed structural information could reveal unique binding sites in H. hepaticus atpB that are absent in human ATP synthase, enabling the design of selective inhibitors.

  • Structure-based virtual screening: Once the three-dimensional structure is determined, computational approaches can be employed to screen large compound libraries for potential inhibitors.

  • Rational drug design: Understanding the conformational changes during the catalytic cycle could allow for the development of transition-state inhibitors that specifically target the bacterial enzyme.

  • Peptide-based inhibitors: Identifying interaction interfaces between atpB and other ATP synthase subunits could lead to the development of peptide mimetics that disrupt complex assembly.

  • Allosteric modulators: Structural studies might reveal allosteric sites that, when targeted, could modulate atpB function without directly interfering with the catalytic site.

These approaches could yield novel antimicrobials with specificity for Helicobacter species, addressing the growing concern of antibiotic resistance in these pathogens.

What are the emerging technologies that could advance research on H. hepaticus atpB?

Several cutting-edge technologies hold promise for advancing our understanding of H. hepaticus atpB:

  • Cryo-electron microscopy: Recent advances in cryo-EM resolution now enable detailed structural analysis of membrane protein complexes like ATP synthase in near-native states.

  • CRISPR-Cas9 genome editing: Precise genetic manipulation of H. hepaticus to create atpB variants for structure-function studies.

  • Single-molecule techniques: Methods such as FRET and optical tweezers could provide insights into the dynamics of ATP synthase function in real time.

  • Microfluidic organ-on-a-chip models: These systems could better recapitulate the complex microenvironments where H. hepaticus resides, allowing for more physiologically relevant studies.

  • Proteomics approaches: Advanced mass spectrometry techniques can identify post-translational modifications and protein-protein interactions involving atpB under various conditions.

  • In silico molecular dynamics simulations: Enhanced computational power allows for increasingly accurate predictions of protein behavior in complex membrane environments.

Implementation of these technologies could significantly accelerate our understanding of H. hepaticus atpB and its role in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.