Recombinant Helicobacter hepaticus ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpE; HH_0593; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Target Names
atpE
Target Protein Sequence
MKFLALLCLGMVGFAFGAEVSGLDMIKSYSIAGAVIGLGIAALGGAIGMGHAAAATISGT ARNPGISGKLLGTMFIALALIEAQVIYTLVLALIALYANPFLS
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase is responsible for ATP production from ADP in the presence of a proton or sodium gradient. F-type ATPases comprise two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the F(0) channel, directly involved in translocation across the membrane. A homomeric c-ring, composed of 10-14 subunits, forms the central stalk rotor element with the F(1) delta and epsilon subunits.
Database Links

KEGG: hhe:HH_0593

STRING: 235279.HH0593

Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the ATP synthase operon in Helicobacter hepaticus compared to other bacteria?

The ATP synthase (atp) operon in Helicobacter species exhibits distinctive organizational features compared to other bacteria. Unlike the typical bacterial arrangement, H. hepaticus and other Helicobacter species lack the atpI accessory subunit. Additionally, Helicobacter genomes feature an atpX gene that shares homology with the F0 b subunit, positioned where the atpE gene (encoding the c subunit) would typically be located . The genes encoding the F0 a and c subunits are positioned elsewhere in the genome, representing a significant deviation from the canonical operon structure observed in most bacteria .

This atypical genomic organization may reflect evolutionary adaptations specific to the Helicobacter genus and their unique ecological niches. The unique arrangement of ATP synthase genes in Helicobacter species suggests specialized regulation and functionality of the F0F1 ATPase complex, potentially related to the bacterium's adaptation to specific host environments.

How does ATP synthase expression in H. hepaticus respond to environmental pH changes?

Microarray experiments with the related species H. pylori have revealed that the ATP synthase complex is downregulated upon exposure to acidic conditions (pH 3.0) . This regulation likely represents an adaptive response to environmental stress. For H. hepaticus, which colonizes the liver and lower intestinal tract of mice rather than the acidic stomach environment inhabited by H. pylori, the pH-dependent regulation may differ.

The research suggests that Helicobacter species have evolved specialized mechanisms to modulate energy metabolism in response to environmental pH. For H. hepaticus specifically, the regulation of ATP synthase may be optimized for the pH conditions of its hepatic and intestinal niches rather than extreme acidity.

What expression systems are most effective for producing recombinant H. hepaticus atpE, and what purification challenges should researchers anticipate?

Based on successful expression strategies for other Helicobacter proteins, heterologous expression in E. coli represents a viable approach for producing recombinant H. hepaticus atpE. The methodology used for cloning and expressing H. hepaticus urease genes provides a useful template . For membrane proteins like atpE, specialized expression strategies may be necessary.

An effective expression protocol might include:

  • PCR amplification of the atpE gene using Platinum Pfx polymerase or similar high-fidelity enzymes

  • Cloning into an expression vector containing an appropriate promoter and affinity tag

  • Expression in E. coli strains optimized for membrane protein production (e.g., C41(DE3) or C43(DE3))

  • Induction under mild conditions (lower temperature, reduced IPTG concentration)

Purification challenges likely include:

  • Membrane protein solubilization requiring detergents

  • Potential protein instability outside the membrane environment

  • Lower expression yields compared to soluble proteins

  • Maintaining protein functionality during extraction and purification

Researchers should consider incorporating stabilizing agents and using gentle solubilization methods to maintain the native conformation of the protein.

What are the functional interactions between H. hepaticus ATP synthase and other virulence factors like urease?

An intriguing relationship may exist between ATP synthase activity and urease function in Helicobacter species. Both enzyme systems involve ion transport across the bacterial membrane and contribute to pH homeostasis. In H. pylori, urease activity is essential for survival in acidic environments, while ATP synthase is downregulated in highly acidic conditions .

For H. hepaticus, which produces abundant urease despite not inhabiting a highly acidic niche , the relationship between these systems may differ from H. pylori. Possible functional interactions include:

  • Energetic coupling - ATP produced by ATP synthase may power nickel transporters required for urease activation

  • Proton economy - Both systems affect proton concentrations across the membrane

  • Regulatory crosstalk - Shared regulatory elements may coordinate expression

The H. hepaticus genome contains genes encoding a nickel transport system (nik operon) located near the urease gene cluster , suggesting possible co-regulation with energy metabolism genes. The table below summarizes key features of these systems:

FeatureATP SynthaseUrease System
Key genes in H. hepaticusatpA-H, atpX, atpEureA, ureB, ureI, ureE-H
FunctionEnergy productionAcid neutralization, nitrogen metabolism
Metal cofactorNoneNickel
Response to acidDownregulated Activated
Genomic organizationSplit operon Clustered genes

What are the optimal conditions for assaying the enzymatic activity of recombinant H. hepaticus ATP synthase subunit c?

Assessing the enzymatic activity of recombinant ATP synthase subunit c requires specialized approaches since this protein is part of a multisubunit complex. Researchers should consider the following methodological approaches:

  • Reconstitution into liposomes: Purified recombinant atpE can be incorporated into artificial lipid vesicles to assess proton translocation.

  • Assembly with other ATP synthase subunits: Co-expression with other F0 components may allow for functional assessment of the partial or complete complex.

  • Proton transport assays: Using pH-sensitive fluorescent dyes to monitor proton movements across liposome membranes containing reconstituted atpE.

  • Analytical techniques: Circular dichroism (CD) spectroscopy and tryptophan fluorescence to assess proper protein folding.

Based on methods used for other membrane proteins, optimal buffer conditions likely include:

  • pH: 7.0-8.0

  • Salt: 100-150 mM NaCl

  • Detergent: n-Dodecyl β-D-maltoside (DDM) or n-Octyl β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration

  • Temperature: 25-30°C

What techniques are most effective for studying atpE gene regulation in H. hepaticus?

Investigating atpE gene regulation requires a combination of molecular and cellular approaches. Based on studies of gene regulation in Helicobacter species, the following methodologies are recommended:

  • Quantitative RT-PCR: To measure atpE transcript levels under various growth conditions, particularly in response to pH changes, nutrient availability, and host cell contact.

  • Transcriptional reporter fusions: Constructing fusions between the atpE promoter region and reporter genes like lacZ or gfp to monitor promoter activity.

  • Electrophoretic mobility shift assays (EMSA): To identify protein-DNA interactions at the atpE promoter, potentially involving regulators like NikR that respond to metal availability .

  • ChIP-seq: To identify transcription factor binding sites genome-wide, including at the atpE locus.

  • RNA-seq: For comprehensive transcriptomic analysis to identify co-regulated genes and regulatory networks involving atpE.

When analyzing atpE regulation, researchers should consider that in Helicobacter species, the gene is located separately from the main atp operon , suggesting potentially unique regulatory mechanisms distinct from those controlling the rest of the ATP synthase complex.

What are the most reliable approaches for generating site-directed mutations in H. hepaticus atpE for structure-function studies?

For structure-function studies of H. hepaticus atpE, researchers should employ a systematic mutagenesis approach targeting conserved residues involved in proton translocation and subunit interaction. Based on molecular techniques used for other Helicobacter genes, the following protocol is recommended:

  • Template preparation: Amplify the atpE gene using high-fidelity DNA polymerase like Platinum Pfx and clone into a suitable vector.

  • Mutagenesis methods:

    • QuikChange site-directed mutagenesis for single amino acid substitutions

    • Overlap extension PCR for multiple or complex mutations

    • Alanine-scanning mutagenesis for systematic functional mapping

  • Mutation verification: Sequence the entire gene to confirm the intended mutations and absence of unwanted changes.

  • Functional assessment: Express both wild-type and mutant proteins under identical conditions to compare:

    • Expression levels (Western blot)

    • Membrane integration (fractionation studies)

    • Proton translocation (fluorescence-based assays)

    • ATP synthesis/hydrolysis (when co-expressed with other subunits)

Key residues to target would include those involved in the proton-binding site, inter-subunit contacts within the c-ring, and interfaces with other F0 subunits.

How might comparative studies of ATP synthase between H. hepaticus and gastric Helicobacter species inform niche adaptation mechanisms?

Comparative analysis of ATP synthase between hepatic and gastric Helicobacter species provides valuable insights into bacterial adaptation to distinct host niches. The search results indicate significant differences in gene organization and regulation between Helicobacter species that colonize different environments .

For gastric Helicobacters like H. pylori, ATP synthase is downregulated in highly acidic conditions , likely as an energy conservation strategy. In contrast, H. hepaticus colonizes the liver and intestinal tract, environments with less extreme pH fluctuations. These differences may be reflected in the regulation and structure of their respective ATP synthase complexes.

Key comparative elements include:

  • Genomic organization: The atpI accessory subunit is absent in gastric Helicobacters , while the genomic location of atpE differs between species.

  • pH response: H. pylori shows downregulation of ATP synthase genes at pH 3.0 , but H. hepaticus may exhibit different regulatory patterns reflecting its non-gastric niche.

  • Evolutionary adaptations: The unique arrangements of ATP synthase genes in different Helicobacter species likely represent adaptations to their specific ecological niches within the host.

Such comparative studies may reveal how modifications to fundamental energy metabolism pathways contribute to host adaptation and niche specialization among bacterial pathogens.

What is the potential for targeting H. hepaticus ATP synthase as a therapeutic approach in experimental mouse models?

ATP synthase represents a potentially valuable therapeutic target due to its essential role in bacterial energy metabolism. For H. hepaticus, which causes liver disease and intestinal inflammation in mice, inhibiting ATP synthase function could disrupt colonization and pathogenesis.

Therapeutic targeting strategies might include:

  • Small molecule inhibitors: Compounds that specifically interact with the c subunit proton channel could block proton translocation and energy generation.

  • Peptide-based inhibitors: Designed to interfere with c-ring assembly or rotation based on structural knowledge of subunit interactions.

  • Immunological approaches: Generating antibodies against exposed portions of ATP synthase components, potentially disrupting function or promoting bacterial clearance.

Several considerations for this approach include:

  • Specificity: Ensuring selective targeting of bacterial versus mammalian ATP synthase

  • Delivery: Developing methods to deliver inhibitors to sites of bacterial colonization

  • Resistance: Monitoring for potential resistance mechanisms

  • Off-target effects: Assessing impacts on commensal microbiota

Research in this direction would require detailed structural information about H. hepaticus ATP synthase components, particularly the c subunit, to enable rational drug design approaches.

How does the expression and function of recombinant H. hepaticus atpE compare in aerobic versus microaerobic growth conditions?

H. hepaticus is a microaerophilic organism that naturally grows under reduced oxygen conditions. When expressing recombinant H. hepaticus proteins, researchers must consider how oxygen levels affect protein folding, activity, and stability.

For atpE specifically, expression and functional studies should compare:

  • Protein yield and solubility under different oxygen conditions

  • Proper membrane integration in aerobic versus microaerobic environments

  • Functional activity when expressed under varying oxygen tensions

Based on research with other Helicobacter proteins, the following observations can guide experimental design:

  • E. coli expression systems grown under microaerobic conditions (2-10% O₂) may better mimic the native environment for H. hepaticus proteins

  • Growth rate will typically be slower under microaerobic conditions, potentially affecting protein yield

  • The redox state of the expression system differs between aerobic and microaerobic growth, potentially affecting disulfide bond formation and protein folding

Researchers should systematically evaluate these parameters when optimizing recombinant atpE expression, particularly if functional studies are planned. A combination of western blotting for protein expression levels and activity assays under different oxygen conditions would provide the most comprehensive assessment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.