Recombinant Helicobacter hepaticus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to PlsY and Its Biological Role

Glycerol-3-phosphate acyltransferase (PlsY) is a critical enzyme in bacterial phospholipid biosynthesis, catalyzing the transfer of acyl groups from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA) as a precursor to membrane phospholipids . While extensively studied in model organisms like Streptococcus pneumoniae and Escherichia coli, limited direct research exists on Helicobacter hepaticus PlsY. Recombinant PlsY proteins, often expressed in heterologous systems (e.g., yeast or E. coli), are essential tools for studying its structure, function, and regulation .

Recombinant PlsY Production and Applications

Production in Heterologous Systems
Recombinant PlsY is typically expressed in yeast or E. coli for structural and biochemical studies. For example, Helicobacter pylori PlsY (a close relative) is produced as a partial recombinant protein with >85% purity, stored in 50% glycerol at -20°C/-80°C .

Key Applications

ApplicationDescriptionRelevance
Enzyme KineticsDetermining substrate specificity (K<sub>m</sub>, k<sub>cat</sub>) for G3P and acyl donors.Informing metabolic pathway regulation .
Structural StudiesMembrane topology analysis via cysteine accessibility or cryo-EM.Elucidating active site organization .
Antibiotic TargetingScreening inhibitors of PlsY to disrupt bacterial membrane synthesis.Potential therapeutic development .

Comparative Analysis of PlsY Across Bacterial Species

While H. hepaticus PlsY remains understudied, insights from related organisms highlight conserved features:

SpeciesKey FeaturesReferences
S. pneumoniaeFive transmembrane segments; Motif 2 glycines critical for G3P binding.
Bacillus anthracisMultiple PlsY homologs; redundancy in acyltransferase activity.
H. pyloriRecombinant PlsY expressed in yeast; partial protein with functional activity.

Challenges and Research Gaps

Lack of Direct H. hepaticus Studies
No peer-reviewed studies explicitly characterize H. hepaticus PlsY. Current understanding relies on homology to other PlsY orthologs.

Potential Research Directions

  1. Pathogenicity Link: Investigate if H. hepaticus PlsY modulates membrane composition during colonization, as seen in H. pylori cholesterol assimilation .

  2. Host-Microbe Interactions: Explore whether PlsY activity affects lipid raft dynamics in host cells, influencing bacterial adhesion .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; HH_0923; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Target Names
plsY
Target Protein Sequence
MSFLSSVLYTLSNINMIFYIVAFLFGGIPFGWLLVKVLYKVDIRDIGSKSIGATNVYRAV KEIDESKAKYLSILTIILDATKGLIVVLGAKLLGMSYETQWSIALLAILGHCYSPYLGFK GGKGVATAIGSVLLLIPVEGICGLIIWGIVGKVFKISSISSLIGVLGTIGLTFVLPYILP LPDCISIIKQINTHTPLVLIGLFIFYTHIPNIKRLFSGEENKVL
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: hhe:HH_0923

STRING: 235279.HH0923

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Helicobacter hepaticus Glycerol-3-phosphate acyltransferase (plsY) and what is its biological significance?

Helicobacter hepaticus Glycerol-3-phosphate acyltransferase (plsY) is a key enzyme involved in the bacterial phospholipid biosynthesis pathway. It catalyzes the acylation of glycerol-3-phosphate (G3P) with long-chain acyl-CoA to form lysophosphatidic acid (LPA), which is the first and rate-limiting step in the de novo synthesis of glycerophospholipids .

In the context of H. hepaticus biology, plsY plays a critical role in membrane lipid biosynthesis, which is essential for bacterial cell envelope integrity, growth, and virulence. The enzyme belongs to a family of acyltransferases that are widely distributed across bacterial species, though with varying substrate preferences and regulatory mechanisms.

The biological significance of this enzyme extends beyond basic bacterial metabolism, as glycerophospholipid synthesis pathways have been implicated in bacterial pathogenesis and host-pathogen interactions in various Helicobacter species .

How can researchers obtain and handle recombinant H. hepaticus plsY protein for experimental use?

Recombinant H. hepaticus plsY can be obtained as a commercially available His-tagged full-length protein expressed in E. coli . When handling this protein, researchers should follow these methodological guidelines:

  • Storage conditions: The lyophilized protein should be stored at -20°C/-80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week .

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

  • Avoiding protein degradation: Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and enzyme activity .

  • Buffer considerations: The protein is supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during storage .

For experimental applications, researchers should consider the specific assay requirements and may need to perform buffer exchanges or additional purification steps depending on the intended application.

H. hepaticus plsY (Glycerol-3-phosphate acyltransferase) has the following structural and functional characteristics:

  • Protein structure:

    • Full-length protein consists of 224 amino acids

    • Contains transmembrane domains typical of membrane-associated acyltransferases

    • Amino acid sequence: MSFLSSVLYTLSNINMIFYIVAFLFGGIPFGWLLVKVLYKVDIRDIGSKSIGATNVYRAVKEIDESKAKYLSILTIILDATKGLIVVLGAKLLGMSYETQWSIALLAILGHCYSPYLGFKGGKGVATAIGSVLLLIPVEGICGLIIWGIVGKVFKISSISSLIGVLGTIGLTFVLPYILPLPDCISIIKQINTHTPLVLIGLFIFYTHIPNIKRLFSGEENKVL

  • Enzymatic function:

    • Catalyzes the first step in glycerophospholipid synthesis

    • Transfers an acyl group from acyl-CoA to the sn-1 position of glycerol-3-phosphate

    • Produces lysophosphatidic acid (LPA), which is subsequently converted to phosphatidic acid by AGPAT enzymes

  • Cellular localization:

    • Membrane-associated protein, likely embedded in the bacterial inner membrane

    • This localization is crucial for its functional role in membrane lipid biosynthesis

  • Substrate specificity:

    • Utilizes glycerol-3-phosphate as the acceptor substrate

    • Shows preference for certain long-chain acyl-CoA donors, though the precise specificity profile for H. hepaticus plsY has not been fully characterized in the provided search results

Understanding these basic characteristics provides the foundation for more advanced functional studies and potential targeting strategies in research applications.

What genetic manipulation techniques are most effective for studying H. hepaticus plsY function?

For genetic manipulation of H. hepaticus to study plsY function, researchers have successfully employed several techniques:

  • Transposon mutagenesis:

    • Construct a transposon with a selectable marker (e.g., chloramphenicol resistance) using a Tn5-based transposon construction vector like pMOD-2 <MCS>

    • Perform in vitro transposition using purified hyperactive Tn5 transposase

    • Transform H. hepaticus with the mutagenized constructs via electroporation

    • Select transformants on chloramphenicol-containing media

  • Electroporation protocol for H. hepaticus transformation:

    • Harvest bacteria after 24-48h growth and wash in buffer containing 15% glycerol, 7% sucrose

    • Use approximately 2μg of plasmid DNA per 40μl of bacterial suspension

    • Perform high-voltage electroporation with a 0.2-cm-gap-size cuvette at 2.5kV (12.5kV/cm)

    • Resuspend transformed bacteria in SOC medium and plate without selection initially

    • After an 8-hour outgrowth period, transfer to selective media

  • Allelic exchange mutagenesis:

    • Create plasmid constructs containing the plsY gene with specific mutations or insertions

    • Include selectable markers (e.g., chloramphenicol resistance) for selection

    • Transform H. hepaticus and select for double crossover events

    • Verify gene replacement via Southern hybridization or PCR analysis

  • Verification of genetic modifications:

    • PCR with gene-specific primers to confirm the presence/absence of the target gene

    • Southern blot analysis to verify chromosomal integration

    • Functional assays to confirm changes in enzymatic activity

    • Gene expression analysis using qRT-PCR

These genetic manipulation techniques typically yield between 10-20 transformants per μg of plasmid DNA . The efficiency of transformation may vary depending on the strain and growth conditions, so optimizing these parameters is essential for successful genetic manipulation of H. hepaticus plsY.

How can researchers design experiments to study the role of plsY in H. hepaticus pathogenesis?

To effectively investigate the role of plsY in H. hepaticus pathogenesis, researchers should consider a comprehensive experimental design approach:

  • In vitro characterization of enzymatic activity:

    • Purify recombinant wild-type and mutant plsY proteins

    • Assay acyltransferase activity using radioactive or fluorescently labeled substrates

    • Compare kinetic parameters (Km, Vmax) between wild-type and mutant enzymes

    • Perform substrate specificity analysis with various acyl-CoA donors

  • Bacterial phenotype characterization:

    • Generate plsY knockout or knockdown mutants using techniques described in question 2.1

    • Compare growth rates and survival under various stress conditions

    • Assess membrane composition and integrity via lipidomic analysis

    • Examine biofilm formation capabilities and resistance to antimicrobial compounds

  • Host-pathogen interaction studies:

    • Infection models using susceptible mouse strains (A/JCr, BALB/c, or IL10-deficient mice)

    • Compare colonization efficiency between wild-type and plsY-mutant H. hepaticus

    • Monitor progression of disease pathology via histological assessment

    • Design timeline experiments to examine both acute and chronic phases of infection:

    TimepointAnalysis MethodsExpected Outcomes
    3-6 weeksPCR for colonization, initial histologyVerification of infection establishment
    3-4 monthsHistopathology, inflammatory markers, HMGB1 detectionEarly pathological changes, immune response assessment
    6-12 monthsComprehensive histopathology, fibrosis assessment (Sirius Red staining)Progressive liver disease evaluation
    12-18 monthsNeoplasia assessment, advanced pathologyLate-stage pathological outcomes
  • Molecular pathogenesis assessment:

    • Analyze host inflammatory responses via cytokine profiling (qPCR, ELISA)

    • Examine activation of signaling pathways (e.g., MAPK, Stat3) via phosphorylation status

    • Quantify serological markers of tissue damage (e.g., HMGB1)

    • Study effects on specific cell populations (e.g., oval cells) using immunohistochemistry

  • Comparative analysis strategies:

    • Include multiple control groups: uninfected, wild-type H. hepaticus-infected, and plsY-mutant-infected

    • Consider using different genetic backgrounds of mice to assess host factors

    • Implement time-course experiments to track disease progression

    • Employ multivariate statistical analyses to identify correlations between bacterial factors and disease parameters

This experimental design framework enables comprehensive assessment of plsY's role in H. hepaticus pathogenesis, from basic enzymatic function to complex host-pathogen interactions.

What are the challenges in expressing and purifying active recombinant H. hepaticus plsY?

Expressing and purifying active recombinant H. hepaticus plsY presents several technical challenges that researchers must address to obtain functional protein:

  • Membrane protein solubility issues:

    • As a membrane-associated enzyme, plsY contains hydrophobic domains that can cause aggregation during expression

    • Solution: Use specialized expression systems designed for membrane proteins, such as:

      • Membrane-mimetic environments (detergents, nanodiscs)

      • Fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

      • Cell-free expression systems with added lipids or detergents

  • Expression host compatibility:

    • E. coli is commonly used for recombinant expression , but codon usage differences between H. hepaticus and E. coli may affect expression efficiency

    • Solution: Optimize codons for the expression host or use specialized E. coli strains with rare tRNA supplements

    • Consider testing multiple expression hosts (e.g., insect cells, yeast) if E. coli systems prove challenging

  • Maintaining enzymatic activity:

    • Detergents used for solubilization may disrupt enzyme structure or function

    • Solution: Screen multiple detergents at various concentrations to identify conditions that preserve activity

    • Consider membrane reconstitution methods to evaluate enzyme function in a native-like environment

  • Purification strategy optimization:

    • His-tagged versions of the protein may exhibit variable binding efficiency to affinity resins

    • Solution: Implement a multi-step purification strategy:

      • Initial IMAC (immobilized metal affinity chromatography) using His-tag

      • Secondary purification steps (ion exchange, size exclusion) to remove contaminants

      • Activity-based purification approaches to enrich for functional protein

  • Protein stability concerns:

    • The purified enzyme may show limited stability in solution

    • Solution: Include stabilizing agents in buffer formulations:

      • Glycerol (5-50%)

      • Trehalose (6%) or other compatible solutes

      • Optimize pH and ionic strength based on activity assays

      • Store at -80°C in small single-use aliquots to avoid freeze-thaw cycles

  • Functional validation methods:

    • Confirming that the purified protein retains enzymatic activity can be challenging

    • Solution: Develop robust activity assays:

      • Radiometric assays tracking incorporation of labeled acyl groups

      • HPLC-based methods to detect product formation

      • Coupled enzymatic assays to monitor reaction progress

By addressing these challenges systematically, researchers can improve the likelihood of obtaining functionally active recombinant H. hepaticus plsY suitable for structural and biochemical studies.

How does H. hepaticus plsY activity contribute to bacterial pathogenesis in the liver?

H. hepaticus plsY activity contributes to bacterial pathogenesis in the liver through several interconnected mechanisms:

Understanding the role of plsY in these pathogenic processes could provide insights into potential therapeutic targets for mitigating H. hepaticus-induced liver disease.

What are the emerging techniques for studying H. hepaticus plsY interactions with host cells?

Several cutting-edge techniques are being applied to elucidate the complex interactions between H. hepaticus plsY and host cells:

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize bacterial lipid trafficking into host cells

    • Live-cell imaging with fluorescently labeled lipids to track metabolic incorporation

    • Correlative light and electron microscopy (CLEM) to connect functional observations with ultrastructural details

    • Multiphoton intravital microscopy to observe host-pathogen interactions in living tissues

  • Multi-omics integration strategies:

    • Lipidomics to characterize changes in host membrane composition following infection

    • Proteomics to identify host proteins that interact with bacterial lipids or the plsY enzyme

    • Transcriptomics to assess global host cell responses to H. hepaticus infection

    • Metabolomics to track flux through lipid metabolic pathways

  • Single-cell analysis methods:

    • Single-cell RNA sequencing to characterize heterogeneous responses in infected tissues

    • Mass cytometry (CyTOF) to profile cell population dynamics during infection

    • Digital spatial profiling to map tissue-level responses with cellular resolution

    • Single-cell proteomics to detect differential protein expression in infected versus uninfected cells

  • Genome-wide screening approaches:

    • CRISPR/Cas9 screening in host cells to identify factors required for H. hepaticus lipid processing

    • Transposon sequencing (Tn-Seq) in H. hepaticus to identify genetic interactions with plsY

    • Synthetic genetic array analysis to map genetic networks involving lipid metabolism

  • Structural biology techniques:

    • Cryo-electron microscopy to determine the structure of plsY in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics and interactions

    • Native mass spectrometry to analyze intact protein complexes involving plsY and host factors

  • Advanced animal models:

    • Humanized mouse models to better mimic human disease conditions

    • Conditional genetic systems to control plsY expression in specific tissues or time points

    • Reporter mice that allow visualization of specific signaling pathways activated by H. hepaticus

  • Computational modeling approaches:

    • Molecular dynamics simulations of plsY-substrate interactions

    • Systems biology models integrating multiple datasets to predict infection outcomes

    • Machine learning applications to identify patterns in host response data

These emerging techniques offer unprecedented opportunities to dissect the molecular mechanisms by which H. hepaticus plsY influences host cell biology and contributes to disease pathogenesis. The integration of multiple approaches will be particularly valuable for developing a comprehensive understanding of these complex host-pathogen interactions.

How can researchers accurately assess plsY enzyme activity in vitro and in vivo?

Accurate assessment of H. hepaticus plsY enzyme activity requires carefully designed assays for both in vitro and in vivo contexts:

In Vitro Activity Assays:

  • Radiometric acyltransferase assay:

    • Principle: Measurement of radiolabeled lysophosphatidic acid (LPA) formation

    • Method:

      • Incubate purified plsY with glycerol-3-phosphate and [14C]-labeled acyl-CoA

      • Extract lipids using organic solvents (chloroform/methanol)

      • Separate products by thin-layer chromatography

      • Quantify radioactivity in LPA band by scintillation counting

    • Advantages: High sensitivity and direct measurement of product formation

  • Spectrophotometric coupled enzyme assay:

    • Principle: Monitoring CoA-SH release during acyltransferase reaction

    • Method:

      • Couple reaction with 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB) to detect free CoA-SH

      • Monitor absorbance change at 412 nm

    • Advantages: Continuous real-time monitoring, adaptable to high-throughput format

  • HPLC-based product detection:

    • Principle: Direct quantification of LPA formation

    • Method:

      • React purified enzyme with substrates

      • Terminate reaction and extract lipids

      • Analyze by HPLC with evaporative light scattering or mass spectrometry detection

    • Advantages: No radioactivity required, high specificity

In Vivo Activity Assessment:

  • Lipidomic profiling of bacterial membrane composition:

    • Principle: Changes in plsY activity will alter bacterial phospholipid profiles

    • Method:

      • Extract total lipids from wild-type and plsY-mutant H. hepaticus

      • Perform liquid chromatography-mass spectrometry (LC-MS) analysis

      • Compare phospholipid species abundances and compositions

    • Advantages: Provides comprehensive view of enzymatic impact on cellular lipidome

  • Metabolic labeling studies:

    • Principle: Track incorporation of labeled precursors into phospholipids

    • Method:

      • Culture bacteria with [13C]-glycerol or [13C]-fatty acids

      • Extract lipids at various time points

      • Analyze isotope incorporation patterns by mass spectrometry

    • Advantages: Provides dynamic information about lipid turnover and synthesis rates

  • Genetic complementation approaches:

    • Principle: Rescue of phenotypes in plsY-deficient mutants

    • Method:

      • Generate plsY conditional knockdown or knockout strains

      • Complement with wild-type or mutant versions of plsY

      • Assess restoration of phospholipid synthesis and bacterial fitness

    • Advantages: Confirms specific role of plsY in observed phenotypes

  • Infection models with enzymatic activity markers:

    • Principle: Correlate bacterial enzymatic activity with host pathology

    • Method:

      • Infect mice with wild-type or plsY-mutant H. hepaticus

      • Collect tissues at various time points

      • Analyze phospholipid profiles in bacterial cells isolated from tissues

      • Correlate with progression of tissue pathology

    • Advantages: Links enzymatic activity to disease development in vivo

When implementing these methods, researchers should consider the following control measures:

  • Include substrate specificity controls to confirm enzyme selectivity

  • Validate assay performance with known inhibitors or activators

  • Perform kinetic analyses to determine optimal reaction conditions

  • Normalize activity measurements to protein concentration or bacterial cell numbers

These methodological approaches provide a comprehensive toolkit for examining H. hepaticus plsY activity across different experimental contexts, enabling researchers to connect enzymatic function with bacterial physiology and pathogenesis.

What are the experimental considerations for studying H. hepaticus plsY in chronic infection models?

Studying H. hepaticus plsY in chronic infection models requires careful experimental design to address the challenges of long-term studies and complex host-pathogen interactions:

  • Experimental timeline planning:

    • Design adequately powered studies with appropriate sample sizes for statistical validity

    • Include multiple timepoints (3, 6, 12, and 18 months post-infection) to capture disease progression

    • Consider staggered start dates for large experiments to manage workload

    • Plan for interim analyses to identify unexpected trends requiring protocol modifications

  • Animal model selection criteria:

    • Choose mouse strains based on research objectives:

      • A/JCr mice for high susceptibility to hepatic inflammation and neoplasia

      • C57BL/6 mice as resistant controls

      • AXB recombinant inbred strains for genetic susceptibility studies

      • IL-10 deficient mice for enhanced inflammatory responses

    • Consider age at infection (typically 4-10 weeks old) as a variable affecting outcomes

    • Standard group sizes range from 5-10 mice per experimental group

  • Infection protocol standardization:

    • Use consistent bacterial culture conditions and growth phase for inoculum preparation

    • Standardize oral gavage technique (typically 0.2-0.3 ml of 10^8-10^9 CFU bacterial suspension)

    • Administer on alternating days for a total of three doses

    • Verify infection status 3 weeks post-inoculation via fecal PCR or culture

  • Monitoring and sample collection protocols:

    • Regular weight measurements to track animal health

    • Periodic fecal sampling to monitor bacterial shedding

    • Humane endpoints based on body condition scoring

    • Comprehensive tissue collection at necropsy:

      • Liver samples for histology, bacterial culture, PCR, and protein analysis

      • Cecal and colonic samples to assess intestinal colonization

      • Serum for cytokine and biomarker analysis

  • Analytical methods for assessing plsY impact:

    • Bacterial colonization quantification:

      • qPCR for H. hepaticus 16S rRNA in tissues

      • Culture-based methods with selective media

      • Visualization with silver staining (Warthin-Starry) in tissue sections

    • Disease progression assessment:

      • Histopathological scoring (inflammation, necrosis, hyperplasia)

      • Fibrosis quantification with Sirius Red staining

      • Immunohistochemistry for specific markers (e.g., oval cell marker A6)

      • Molecular analyses (qPCR for inflammatory cytokines, Western blotting for HMGB1 and signaling proteins)

  • Specialized approaches for plsY-focused studies:

    • Compare wild-type H. hepaticus with plsY mutants (knockdown or site-directed mutants)

    • Track phospholipid profiles in bacteria isolated from infected tissues

    • Analyze host lipidome changes in response to infection

    • Evaluate impact of pharmacological modulators of lipid metabolism

  • Data integration and statistical analysis:

    • Multivariate statistical methods to correlate bacterial factors with disease parameters

    • Longitudinal data analysis approaches for time-course experiments

    • Sample size calculations based on expected effect sizes from preliminary data

    • Account for sex as a biological variable in analysis

This comprehensive approach enables researchers to effectively study the role of H. hepaticus plsY in chronic infection models, linking enzymatic function to long-term disease outcomes in a standardized and reproducible manner.

How can H. hepaticus plsY research contribute to understanding human hepatobiliary diseases?

Research on H. hepaticus plsY has significant translational potential for understanding human hepatobiliary diseases through several interconnected pathways:

  • Helicobacter species in human hepatobiliary cancers:

    • Recent epidemiological evidence suggests associations between Helicobacter species and human hepatobiliary cancers

    • A multiplex serological study found that seropositivity to certain H. hepaticus antigens was associated with higher risk of biliary cancer (OR: 5.01; 95% CI: 1.53, 16.40 for HH0407 antigen)

    • H. hepaticus and H. bilis have been detected in human bile and hepatobiliary tissue samples

    • Understanding the role of plsY in the pathogenesis of these infections could provide mechanistic insights

  • Comparative pathogenesis models:

    • H. hepaticus infection in mice serves as a model for studying inflammation-driven carcinogenesis

    • The progression from chronic inflammation to preneoplastic changes and eventually cancer mirrors human disease development

    • plsY-related lipid metabolism may influence this progression through:

      • Alteration of inflammatory microenvironments

      • Modulation of cell membrane composition affecting signaling

      • Production of lipid mediators that influence immune responses

  • Molecular mechanisms shared with human diseases:

    • H. hepaticus infection activates signaling pathways implicated in human liver diseases:

      • MAPK (Erk1/2 and p38) signaling

      • Stat3 activation

      • HMGB1 release and associated inflammatory cascades

    • These pathways are also dysregulated in various human hepatobiliary conditions, including:

      • Non-alcoholic steatohepatitis (NASH)

      • Primary sclerosing cholangitis

      • Viral hepatitis-associated liver damage

      • Hepatocellular carcinoma

  • Metabolic pathway interconnections:

    • Glycerol-3-phosphate acyltransferases play critical roles in mammalian metabolism

    • GPAT enzymes contribute to the development of obesity, hepatic steatosis, and insulin resistance in humans

    • Bacterial plsY may interact with or influence host lipid metabolism during infection

    • This bacterial-host metabolic crosstalk could be relevant to understanding human metabolic liver diseases

  • Biomarker development potential:

    • H. hepaticus infection leads to specific serum biomarker changes, such as increased HMGB1

    • Similar biomarkers may be useful for early detection of inflammation-driven hepatobiliary diseases in humans

    • Understanding the role of plsY in triggering these biomarker changes could refine their diagnostic utility

  • Therapeutic target identification:

    • If bacterial plsY contributes significantly to pathogenesis, it represents a potential therapeutic target

    • Inhibitors of bacterial phospholipid synthesis could help control bacterial persistence

    • The structural and functional differences between bacterial plsY and mammalian GPATs provide opportunities for selective targeting

Future translational research should focus on establishing more direct connections between H. hepaticus plsY activity and specific mechanisms of human hepatobiliary disease, particularly in inflammatory and neoplastic conditions where Helicobacter species have been implicated as potential contributing factors.

What are the contradictions and knowledge gaps in current research on H. hepaticus plsY?

Despite growing research on H. hepaticus and its pathogenic mechanisms, several contradictions and knowledge gaps exist regarding plsY that require further investigation:

  • Functional characterization discrepancies:

    • While the gene encoding H. hepaticus plsY has been identified, detailed biochemical characterization of the enzyme's kinetic properties and substrate preferences remains limited

    • Differences between predicted function based on sequence homology and actual enzymatic behavior have not been thoroughly addressed

    • The exact role of plsY in H. hepaticus phospholipid homeostasis under various environmental conditions is poorly defined

  • Pathogenesis contribution uncertainties:

    • While H. hepaticus clearly causes liver pathology in susceptible mouse strains , the specific contribution of plsY to this process hasn't been directly demonstrated

    • It remains unclear whether plsY activity is:

      • Essential for bacterial survival in the host

      • Directly involved in triggering host inflammatory responses

      • A contributor to bacterial persistence in chronic infection

  • Host response contradictions:

    • Mouse strain-dependent susceptibility to H. hepaticus suggests complex host-pathogen interactions

    • Whether these differences relate to how host cells respond to bacterial lipids or other factors remains undetermined

    • The relationship between bacterial phospholipid synthesis and activation of specific host immune pathways needs clarification

  • Translational relevance questions:

    • While Helicobacter species have been associated with human hepatobiliary diseases , the relevance of findings from mouse models to human infections is debated

    • Contradictions exist in epidemiological studies regarding the strength of association between Helicobacter species and human liver diseases

    • The applicability of plsY-focused research to human pathology requires validation

  • Technical challenges creating knowledge gaps:

    • Difficulties in genetic manipulation of H. hepaticus have limited the creation of clean plsY knockout strains

    • Long-term infection studies (12-18 months) are resource-intensive and prone to confounding factors

    • Challenges in expressing and purifying active recombinant enzyme have hampered structural studies

  • Research focus imbalances:

    • Most studies have examined general H. hepaticus pathogenesis rather than specific enzymatic pathways

    • Research on H. hepaticus PAI and cytolethal distending toxin has overshadowed metabolic enzyme studies

    • The potential interactions between virulence factors and metabolic enzymes remain largely unexplored

  • Comparative biology limitations:

    • Differences between plsY enzymes across Helicobacter species have not been systematically investigated

    • The evolution of plsY and its relationship to host adaptation is poorly understood

    • Functional comparisons with related enzymes in other bacteria would provide valuable context

Addressing these contradictions and knowledge gaps will require:

  • Development of improved genetic tools for H. hepaticus

  • Systematic biochemical characterization of recombinant plsY

  • Creation of conditional or tissue-specific knockdown systems

  • Integration of multiple -omics approaches (genomics, transcriptomics, proteomics, lipidomics)

  • Collaborative research combining expertise in bacterial metabolism, host immunology, and hepatobiliary pathology

These efforts will help resolve current uncertainties and establish a more comprehensive understanding of H. hepaticus plsY's role in bacterial physiology and host-pathogen interactions.

What emerging approaches could advance H. hepaticus plsY research in the next five years?

The next five years are likely to see significant advances in H. hepaticus plsY research through several emerging technological and conceptual approaches:

  • CRISPR-based genetic manipulation tools:

    • Adaptation of CRISPR-Cas systems for efficient gene editing in Helicobacter species

    • Development of CRISPRi/CRISPRa systems for conditional gene regulation

    • Creation of precise point mutations to study structure-function relationships in plsY

    • High-throughput screening of genetic interactions using CRISPR libraries

  • Advanced structural biology approaches:

    • Cryo-electron microscopy to determine plsY structure in membrane environments

    • Integrative structural biology combining multiple techniques (NMR, X-ray, computational modeling)

    • Time-resolved structural studies to capture enzyme dynamics during catalysis

    • Structure-guided drug design targeting bacterial plsY

  • Synthetic biology and metabolic engineering:

    • Creation of synthetic H. hepaticus strains with modified lipid metabolism

    • Development of biosensors to monitor plsY activity in real-time

    • Engineering of bacteria with orthogonal lipid synthesis pathways

    • Synthetic genetic circuit approaches to study plsY regulation

  • Microbiome and co-infection models:

    • Studying H. hepaticus plsY function in complex microbial communities

    • Investigation of how plsY-dependent lipid synthesis affects microbial community dynamics

    • Examination of co-infection scenarios (viral hepatitis + H. hepaticus)

    • Microbiome transplantation studies to assess transmissibility of disease phenotypes

  • Advanced in vivo imaging technologies:

    • Intravital microscopy to visualize H. hepaticus-host interactions in real-time

    • Multiplexed FISH approaches to localize bacteria within tissue microenvironments

    • Multimodal imaging combining functional and structural information

    • Development of activity-based probes to track plsY function in vivo

  • Organ-on-chip and organoid technologies:

    • Liver-on-chip systems to model H. hepaticus infection in controlled environments

    • Hepatic organoids to study species-specific responses to infection

    • Co-culture systems combining bacterial and mammalian cells

    • High-throughput screening platforms for host-pathogen interactions

  • Multi-omics data integration approaches:

    • Comprehensive multi-omics profiling of infection models (genomics, transcriptomics, proteomics, metabolomics, lipidomics)

    • Network analysis and systems biology approaches to identify key nodes in host-pathogen interactions

    • Machine learning applications to predict outcomes from complex datasets

    • Development of computational models of lipid metabolism during infection

  • Novel therapeutic strategies:

    • Targeted inhibition of bacterial lipid synthesis pathways

    • Metabolic modulation to create unfavorable environments for bacterial persistence

    • Immune-metabolic combination approaches targeting both bacterial factors and host responses

    • Precision microbiome interventions to counteract pathogenic effects

  • Translational research directions:

    • Development of diagnostic biomarkers based on lipid metabolism alterations

    • Comparative studies between mouse models and human samples

    • Clinical investigations of Helicobacter species in liver disease patients

    • Prospective studies linking bacterial factors to disease outcomes

These emerging approaches will likely overcome current technical limitations and knowledge gaps, providing unprecedented insights into the role of H. hepaticus plsY in bacterial physiology and host-pathogen interactions. The integration of multiple advanced technologies will be particularly powerful in unraveling the complex mechanisms underlying H. hepaticus-induced liver pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.