Recombinant Helicobacter hepaticus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetails
SpeciesHelicobacter hepaticus
Expression SystemE. coli
TagN-terminal His tag
Molecular Weight~66 kDa (calculated)
SequenceFull-length (1-591 aa)
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0) at -20°C/-80°C
ReconstitutionDeionized water with optional 5–50% glycerol for stability

The protein’s structure includes five transmembrane domains (TMs) and a cytoplasmic helical hairpin between TM2 and TM3, as inferred from structural homology with E. coli YidC .

Functional Role in Membrane Protein Insertion

YidC is a conserved bacterial insertase that facilitates the co-translational integration of membrane proteins either independently or alongside the Sec translocon . In H. hepaticus, YidC likely performs dual roles:

  • Sec-independent insertion: Mediates integration of single-spanning membrane proteins (e.g., phage Pf3 coat protein analogs) via direct interaction with hydrophobic domains .

  • Sec-YidC cooperation: Assists in the assembly of multi-pass transmembrane proteins, such as respiratory complexes, by stabilizing transmembrane helices during Sec-mediated translocation .

Mechanistically, YidC’s hydrophilic cavity exposed to the lipid bilayer enables it to chaperone nascent membrane proteins into the membrane, as demonstrated in cryo-EM studies of ribosome-YidC complexes .

Pathogenicity Link

While H. hepaticus YidC’s direct role in virulence is uncharacterized, homologs in related pathogens (e.g., Helicobacter pylori) contribute to membrane protein assembly critical for host colonization and immune evasion . Its interaction with oxidative stress-response proteins (e.g., Dps) suggests a potential role in bacterial survival under host-induced stress .

Comparative Analysis with Other YidC Orthologs

FeatureH. hepaticus YidCE. coli YidCMitochondrial Oxa1
Transmembrane Domains555–6
Sec AssociationLikely (inferred)Direct (SecYEGDF complex) None (standalone insertase)
Substrate SpecificitySingle/multi-pass proteinsSingle/multi-pass proteinsInner membrane proteins
Role in PathogenesisIndirect (hypothesized)Non-pathogenic modelNon-pathogenic

Challenges and Future Directions

  • Structural gaps: No high-resolution structure of H. hepaticus YidC exists; homology modeling remains reliant on E. coli data .

  • Functional validation: Further studies are needed to clarify its interaction with H. hepaticus-specific substrates (e.g., virulence factors) .

  • Therapeutic potential: YidC inhibitors could disrupt membrane biogenesis in Helicobacter species, offering a novel antimicrobial strategy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend brief centrifugation of the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for your use.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize development of the specified tag.
Synonyms
yidC; HH_0112; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Target Names
yidC
Target Protein Sequence
MYRPNEQDNGMSLTRVLIAIGLSIAFFAIYAYFFPQKPHQNTHQAHTAQNTQDTQESIQA STHTEINTQVAPHQNIQDSTQSVQNEISSSAQMPHSLKQTIIARVDSDEFELEIDALGRI KQVYLKDEKFIRHEQTSLFAMIGEVLGMKPAHKEKRDKLPLFGDSQLHTMEMRFSDTSIN QQAFDTPYTANISYIKLENAPVEIVLTQNLGNLVIKKYLTIHPNLAYDVRLELSKPNIEY FVSNGMRPTADTDTYAFRGVITRNNIDGVLTKFEDGDASSDYLAKNAADIRSSSFVASVD RYYTSLFFSNAPKGLYVVMSGDNAHNPMPYVRFEGDAEFAGYIGPKEYHELQGIENTLTD VVEYGRITFFAKPLFLLLEYLYDLCGNWGWAIVLLTLIVRIVLYPLTYKGMVSMQKLKDL APKMKDLQTRYKDDPQKLQIHMMDLYKKHGANPLGGCLPLILQIPVFFAIYRVLHNAVEL KSSAWILWITDLSAIDPYFVLPVLMGVSMYISQKLTPSNFTDPMQEKIFKMLPWVFTIFF IIFPFPAGLVLYWTINNVFSIIQQISINKIMEGKKAKEIAAHHDEKTNKRG
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as in the integration of at least some lipoproteins. YidC aids in the folding of multispanning membrane proteins.
Database Links

KEGG: hhe:HH_0112

STRING: 235279.HH0112

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Helicobacter hepaticus and why is it significant in research?

Helicobacter hepaticus is a microaerobic bacterium first identified in the 1990s that causes chronic active hepatitis and inflammatory bowel disease (IBD) in murine models . This pathogen has become a valuable model organism for studying host-microbiota interactions because it naturally colonizes the lower bowel and biliary tract of mice, producing diseases that resemble human IBD in susceptible hosts .

H. hepaticus has demonstrated ability to induce colitis, colorectal cancer, and extraintestinal diseases in mice with compromised immune function, making it an excellent model for studying inflammatory disease mechanisms . Researchers utilize this bacterium to investigate both inflammatory and tolerogenic immune responses, providing crucial insights into intestinal immunity regulation . The complete genomic sequence of H. hepaticus has facilitated identification of virulence factors and pathogenesis mechanisms, potentially informing novel therapeutic approaches for inflammatory bowel diseases .

What is the YidC insertase and what functions does it perform?

YidC is a highly conserved membrane protein insertase that facilitates the insertion and folding of transmembrane proteins into cellular membranes . This protein plays a critical role in membrane protein biogenesis by catalyzing the thermodynamically unfavorable process of inserting hydrophilic polypeptide residues through the hydrophobic core of the membrane .

Functionally, YidC operates through a multi-stage process: within approximately 2 milliseconds, its cytoplasmic α-helical hairpin binds substrate polypeptides with high conformational variability; then within 52 milliseconds, it strengthens this binding and transfers the substrate to a membrane-inserted, folded state using its hydrophilic groove . The significance of YidC extends beyond bacteria, as it shares homology with Alb3 in chloroplasts and Oxa1 in mitochondria, suggesting conservation of insertion mechanisms across different domains of life .

How are H. hepaticus infections established and monitored in laboratory settings?

Establishing controlled H. hepaticus infections requires specific pathogen-free mice (typically BALB/c) confirmed free of Helicobacter species and exogenous murine viral pathogens . Experimental protocols typically involve:

  • Cultivation of H. hepaticus strains (e.g., 3B1/ATCC 51449) on Brucella agar supplemented with sheep blood and antibiotics under microaerobic conditions (85% N₂, 10% CO₂, 5% O₂) at 37°C

  • Oral gavage inoculation with standardized bacterial suspensions

  • Maintenance of mice under controlled environmental conditions (22-26°C, 40-60% humidity, 12h:12h light-dark cycle)

For monitoring infection, researchers employ:

  • Quantitative PCR (qPCR) to determine bacterial colonization levels in tissues including colon and liver

  • Serological assays using enzyme-linked immunosorbent assay (ELISA) with either detergent extracts of H. hepaticus or recombinant immunogenic proteins like MAP18

  • Histopathological examination of tissue sections stained with techniques such as Sirius Red for liver fibrosis

  • Measurement of inflammatory markers using cytokine expression analysis and specific ELISA kits for mediators like HMGB1

What techniques are used to study YidC-mediated membrane protein insertion?

Researchers employ multiple complementary approaches to investigate YidC function:

  • In vitro translation/insertion assays: Using inverted membrane vesicles (INVs) prepared from bacterial strains with varying levels of YidC or its interactors, researchers measure insertion of model substrates like Pf3 coat protein, M13 procoat H5, and F0c . After insertion, proteinase K digestion leaves only membrane-protected fragments (MPFs), which are quantified to assess insertion efficiency .

  • Biophysical techniques: Single-molecule force spectroscopy and fluorescence spectroscopy allow precise measurement of binding kinetics and conformational changes during insertion .

  • Molecular dynamics simulations: These computational approaches model insertion processes at atomic resolution, complementing experimental findings .

  • Charge manipulation experiments: By altering charged residues in substrate proteins and measuring insertion efficiency with and without proton motive force (PMF), researchers determine how YidC handles charge translocation .

Table 1: Experimental approaches for studying YidC function

TechniqueApplicationsAdvantagesLimitations
In vitro translation/insertion assaysQuantitative assessment of insertion efficiencyDirect functional measurementLimited physiological context
Single-molecule spectroscopyBinding kinetics, conformational changesHigh temporal resolution (millisecond range)Technical complexity
Molecular dynamics simulationsAtomic-level insertion mechanismsDetailed structural insightsComputational limitations
Charge manipulation experimentsRole of PMF in insertionMechanistic insightsPotentially non-native substrates

How do protein interactors influence YidC function?

Recent research has identified YibN as a significant physical and functional interactor of YidC that enhances membrane protein insertion efficiency . Experimental data shows that inverted membrane vesicles (INVs) enriched for YibN support a 1.5-1.8-fold stimulation of insertion for substrates including Pf3 coat, M13 procoat H5, and F0c, whereas INVs enriched for YidC alone do not show similar stimulation .

The interaction effects exhibit substrate specificity. For instance, YibN enhances insertion of wild-type SecG protein (producing three membrane-protected fragments after proteinase K digestion), but shows minimal enhancement with the SecG I20E mutant . This differential effect suggests that YibN's influence may depend on specific properties of the substrate proteins, potentially related to charged residues or structural features.

The methodological framework for identifying and characterizing such interactions includes:

  • Co-immunoprecipitation and pull-down assays for physical interaction detection

  • Comparative functional assays using wild-type and mutant substrates

  • Manipulation of membrane conditions to assess contextual effects on interaction outcomes

What is the relationship between H. hepaticus colonization dynamics and disease progression?

Longitudinal studies tracking H. hepaticus infection provide important insights into the complex relationship between bacterial colonization and disease development. Research shows that H. hepaticus colonization increases from 8 to 24 weeks post-infection (WPI), correlating with worsening pathological lesions in both intestine and liver .

Table 2: H. hepaticus colonization dynamics and associated pathology over time

Time PointColonization PatternAssociated Pathology
Early infection (8-24 WPI)Progressive increase in colon and liverDevelopment of initial lesions
Intermediate (6 MPI)Plateau reached in colon, continuing increase in liverProgressive intestinal and hepatic inflammation
Late infection (12-18 MPI)Stable colonization in both colon and liverChronic inflammatory state with potential fibrosis

These findings suggest that while initial colonization drives disease initiation, host immune responses likely play an increasingly dominant role in disease progression during chronic infection .

How do the proton motive force (PMF) and membrane composition affect YidC-mediated insertion?

The efficiency of YidC-mediated membrane protein insertion is significantly influenced by both the proton motive force (PMF) and membrane phospholipid composition. The PMF appears to assist YidC in translocating charged residues across the membrane, particularly negatively charged ones .

A critical research question concerns the maximum number of negative charges that YidC can handle with PMF assistance in the absence of the SecY protein . Experimental approaches investigating this include:

  • Systematic introduction of negatively charged residues into substrate proteins

  • Comparison of insertion efficiency with and without PMF

  • Assessment of YidC-substrate interactions under varying conditions

Researchers have explored whether interactions between YidC and substrates like Pf3-Lep occur even without PMF, and whether YidC-independent insertion mechanisms exist under certain conditions . These studies help delineate direct versus indirect effects of PMF on the translocation of nascent N-terminal domains.

The membrane lipid environment also impacts YidC function, with evidence suggesting that interactors like YibN may influence lipid organization around the insertase, thereby modulating its activity . Understanding these complex interrelationships is essential for developing comprehensive models of membrane protein biogenesis.

How are recombinant H. hepaticus membrane proteins expressed and purified?

The expression and purification of recombinant H. hepaticus membrane proteins follow established protocols with specific adaptations for membrane proteins. Using MAP18 (an 18-kDa immunogenic membrane-associated protein) as an example, the process involves:

  • Genomic library construction: H. hepaticus genomic DNA is fragmented, cloned into appropriate vectors, and screened using sera from infected mice to identify immunoreactive proteins .

  • Gene identification and characterization: Analysis of positive clones led to identification of a 459-bp open reading frame encoding MAP18, with predicted features including a membrane-trafficking signal sequence and signal peptidase II cleavage site .

  • Recombinant expression: The gene is cloned into expression vectors (typically as fusion proteins to enhance solubility and facilitate purification). For MAP18, expression as a glutathione S-transferase (GST) fusion protein in E. coli yielded a 44-kDa recombinant protein .

  • Purification: Affinity chromatography methods appropriate to the fusion tag are employed. For GST-MAP18, glutathione-based affinity purification was utilized .

  • Validation: Western blotting with sera from infected and control mice confirms specificity. GST-MAP18 was detected with sera from H. hepaticus-infected mice but not with sera from mice infected with other Helicobacter species or uninfected controls .

What applications exist for recombinant H. hepaticus membrane proteins?

Recombinant H. hepaticus membrane proteins have several research and diagnostic applications:

  • Serological diagnostics: Recombinant proteins like GST-MAP18 serve as antigens in ELISA-based detection of H. hepaticus infection . Although the recombinant protein-based ELISA showed lower sensitivity (66%) compared to detergent extract-based ELISA (89%), both maintained high specificity (98%) .

  • Immunological research: Purified recombinant proteins enable studies of specific immune responses to H. hepaticus antigens, helping elucidate mechanisms of both pathogenesis and immune regulation.

  • Vaccine development: Identified immunogenic proteins represent potential vaccine candidates for preventing H. hepaticus infection in research colonies.

  • Structure-function studies: Recombinant expression facilitates structural characterization and functional analysis of membrane proteins, including potential virulence factors.

The methodological approaches for using these proteins must account for their specific properties. For instance, the finding that antibodies to MAP18 are not detected in all infected mice (contributing to lower ELISA sensitivity) highlights the importance of considering host-specific immune responses when developing diagnostic or therapeutic applications .

What emerging approaches might advance understanding of YidC-mediated insertion?

Several promising approaches could enhance our understanding of YidC-mediated membrane protein insertion:

  • Cryo-electron microscopy: High-resolution structural studies of YidC during different stages of the insertion process, potentially in complex with substrate proteins and interactors like YibN.

  • Single-molecule FRET studies: Real-time monitoring of conformational changes during insertion with improved temporal resolution.

  • Synthetic biology approaches: Engineering membrane protein substrates with systematic variations in charge, hydrophobicity, and structural features to define insertion determinants.

  • Integrative modeling: Combining experimental data with advanced computational approaches to develop comprehensive models of the insertion process, incorporating effects of PMF, membrane composition, and protein interactors .

  • Cross-species comparative studies: Examination of YidC homologs across diverse bacteria, archaea, and eukaryotic organelles to identify conserved and divergent mechanisms.

How might H. hepaticus research inform understanding of human inflammatory diseases?

H. hepaticus research has significant translational potential for human inflammatory diseases:

  • Microbiome-host interactions: The H. hepaticus model provides valuable insights into how specific gut bacteria trigger inflammatory responses, informing microbiome studies in human IBD .

  • Regulatory T cell function: H. hepaticus infection models have helped define Treg roles in controlling inflammation, with direct relevance to human immunoregulatory disorders .

  • Disease biomarkers: Molecular mediators identified in H. hepaticus-induced inflammation, such as HMGB1, represent potential biomarkers or therapeutic targets for human inflammatory diseases .

  • Virulence mechanisms: Understanding how H. hepaticus virulence factors induce inflammation may reveal conserved pathogenic mechanisms applicable to human bacterial pathogens .

  • Cancer promotion: The link between chronic H. hepaticus infection and colorectal cancer development provides a model for studying inflammation-associated carcinogenesis .

By delineating the molecular mechanisms underlying H. hepaticus pathogenesis and YidC-mediated protein insertion, researchers gain valuable insights into fundamental biological processes with relevance to human health and disease. The continued integration of structural, functional, and systems biology approaches promises to advance our understanding of these complex systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.