Recombinant Helicobacter hepaticus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in H. hepaticus Physiology

NuoK is integral to complex I, which catalyzes the transfer of electrons from NADH to quinone while translocating protons across the membrane, contributing to ATP synthesis . Key functional insights include:

  • Proton-Translocating Activity: Complex I in H. hepaticus includes diverse respiratory components (e.g., NADH-1, NADH-2 dehydrogenases, cytochrome cbb3 oxidase), enabling adaptation to oxidative stress .

  • Oxidative Stress Response: While H. hepaticus employs MdaB (a quinone reductase) to reduce quinones via NADPH , nuoK operates within complex I to mitigate oxidative damage by maintaining redox balance .

  • Enzyme Specificity: NuoK subunit-specific activity for NADH oxidation is not explicitly quantified in H. hepaticus, but structural homology to H. pylori MdaB (66% sequence identity) suggests conserved catalytic mechanisms .

Research Applications and Experimental Data

Recombinant nuoK is primarily used in biochemical and immunological studies:

Table 1: Comparative Analysis of H. hepaticus NuoK and Related Proteins

ParameterH. hepaticus nuoK H. pylori MdaB
Electron DonorNADH (primary)NADPH (primary)
Catalytic EfficiencyNot quantified~20× lower than H. pylori MdaB
Subunit StructureFull-length, His-taggedFlavoprotein, no tag
Oxidative Stress RoleProton translocation, ATP synthesisQuinone reduction, detoxification

Key Research Findings

  • Expression and Purification: Recombinant nuoK is expressed in E. coli and purified via affinity chromatography, yielding a homogeneous product suitable for structural or functional assays .

  • Functional Interactions: NuoK participates in complex I’s modular architecture, which includes fused subunits (e.g., NuoCD in some bacterial lineages) to optimize electron transfer .

  • Pathogenic Relevance: H. hepaticus complex I may contribute to its resilience in oxidative environments, such as the liver and intestinal tract .

Challenges and Considerations

  • Stability: Lyophilized nuoK requires reconstitution in deionized water with glycerol (5-50%) for long-term stability . Repeated freeze-thaw cycles degrade activity.

  • Functional Assays: Direct measurement of nuoK’s NADH-quinone oxidoreductase activity is limited by its dependence on other complex I subunits, necessitating in vitro reconstitution of the full complex .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nuoK; HH_1593; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Target Names
nuoK
Target Protein Sequence
MISLNHYLLLCVILFCIGLFGILRRSNILMLFFSTEILLNAINIGFVAIGSYLNDLNGEI FALFIIAIAASEIAVGLGLVVIWYKKHRTLDITTLQNLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this specific species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving redox energy in a proton gradient.
Database Links

KEGG: hhe:HH_1593

STRING: 235279.HH1593

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Helicobacter hepaticus and why is it important in research?

Helicobacter hepaticus is an enterohepatic Helicobacter species that colonizes the lower gastrointestinal tract and hepatobiliary system of mice. It has significant research importance because it causes chronic active hepatitis and typhlocolitis in immunocompetent mice and can lead to liver carcinoma in susceptible strains . H. hepaticus infection has been documented to induce inflammatory bowel disease in certain immunodeficient mice, making it a valuable model organism for studying human gastrointestinal and liver diseases . Recent research has detected H. hepaticus in human bile samples, with significantly higher prevalence in patients with cholelithiasis (41%) and cholecystitis with gastric cancer (36%), suggesting potential clinical relevance beyond animal models .

How does H. hepaticus respond to oxidative stress conditions?

H. hepaticus employs multiple mechanisms to combat oxidative stress. Wild-type H. hepaticus can tolerate up to 6% O₂ for growth, demonstrating its microaerophilic nature . The bacterium utilizes specialized enzymes like NADPH quinone reductase (MdaB) to detoxify reactive oxygen species. When exposed to oxidative stress, H. hepaticus constitutively upregulates superoxide dismutase, which is different from the related species H. pylori . This upregulation represents an adaptive response to counteract the harmful effects of oxidative stress. The bacterium's sensitivity to oxidative stress reagents including H₂O₂, cumene hydroperoxide, t-butyl hydroperoxide, and paraquat increases when oxidative stress response genes are disrupted, highlighting the importance of these pathways for survival .

What is the role of quinone oxidoreductases in bacterial metabolism?

Quinone oxidoreductases, including NADH-quinone oxidoreductase complexes, play essential roles in bacterial electron transport chains and energy metabolism. In H. hepaticus, the MdaB protein functions as a flavoprotein that catalyzes quinone reduction using a two-electron transfer mechanism from NAD(P)H to quinone . This enzyme shows substrate specificity, with activity ranging from 0.92 to 4.6 U/mg of protein when using NADPH as an electron donor and various quinones as electron acceptors . The enzyme strongly prefers NADPH over NADH as an electron donor (approximately 30-fold higher activity), as shown in the following activity measurements:

Electron acceptorEnzyme activity with NADPH (U/mg)Enzyme activity with NADH (U/mg)
Coenzyme Q₀4.6 ± 0.40.13 ± 0.02
Coenzyme Q₁3.8 ± 0.20.09 ± 0.02
Menadione1.7 ± 0.20.06 ± 0.01
1,4-Naphthoquinone2.7 ± 0.30.05 ± 0.01

These enzymes contribute significantly to the bacterium's ability to survive under varying oxygen levels and oxidative stress conditions .

What are the recommended methods for expressing recombinant H. hepaticus nuoK protein?

For expressing recombinant H. hepaticus proteins, established protocols from related Helicobacter studies can be adapted. The transformation approach should include electroporation using a Gene Pulser, followed by resuspension in SOC medium (2% tryptone, 0.5% yeast extract, 10 mM NaCl, 2.5 mM KCl, 10 mM MgCl₂, 10 mM MgSO₄, 10 mM glucose) . After initial growth without selection for approximately 8 hours, bacteria should be harvested, resuspended, and plated with appropriate antibiotic selection .

For protein purification, affinity chromatography is recommended based on successful approaches with related H. hepaticus oxidoreductases. Following purification, spectrophotometric analysis can confirm proper protein folding, as observed with MdaB which shows characteristic flavin absorption spectrum with peaks at 456 nm, 376 nm, and shoulders at 429 and 484 nm . Enzyme activity assays should be conducted measuring the decrease in absorbance at 340 nm during NADPH or NADH oxidation to assess functional integrity of the recombinant protein .

How can researchers create and validate nuoK mutant strains in H. hepaticus?

Creating nuoK mutant strains requires insertional mutagenesis techniques similar to those successfully employed for mdaB mutants in H. hepaticus . The process should begin with designing primers to amplify the nuoK gene with flanking regions to facilitate homologous recombination. Insertional mutagenesis can be performed by introducing an antibiotic resistance cassette within the coding sequence.

For validation of successful mutagenesis, researchers should employ PCR verification with primers flanking the insertion site, followed by sequencing to confirm the mutation. Phenotypic validation should include growth curve analysis under varying oxygen concentrations (particularly around 6% O₂, which is tolerated by wild-type but challenging for oxidative stress-sensitive mutants) . Further validation should include sensitivity testing to oxidative stress reagents such as H₂O₂, cumene hydroperoxide, t-butyl hydroperoxide, and paraquat . Additionally, researchers should verify that observed phenotypes are specifically due to nuoK disruption by creating complemented strains or confirming that adjacent genes are not affected, similar to how researchers verified that disruption of the gene downstream of mdaB (HH1473) did not contribute to the oxidative stress phenotype in mdaB mutants .

What assays can be used to measure nuoK-associated quinone reductase activity?

Quinone reductase activity associated with nuoK can be measured using spectrophotometric assays that monitor the decrease in absorbance at 340 nm, corresponding to NADPH or NADH oxidation . The standard reaction mixture should contain varying concentrations of electron donors (NADPH/NADH) and electron acceptors (different quinones) in appropriate buffer conditions.

To determine substrate specificity and kinetic parameters, researchers should test multiple quinone substrates including Coenzyme Q₀, Coenzyme Q₁, menadione, and 1,4-naphthoquinone . Both NADPH and NADH should be tested as electron donors to determine cofactor preference. Enzyme kinetics (Km, Vmax) should be calculated for each substrate combination. Specific activity should be expressed in units per milligram of protein, where one unit represents the amount of enzyme that catalyzes the oxidation of 1 μmol of NADPH or NADH per minute .

How does nuoK contribute to H. hepaticus pathogenesis in liver disease models?

The contribution of nuoK to H. hepaticus pathogenesis likely involves its role in energy metabolism and oxidative stress response, similar to related quinone reductases. To investigate this question, researchers should employ in vivo infection models using both wild-type and nuoK mutant strains. The mouse infection protocol should include oral gavage administration of bacterial suspensions (optical density of 1.0 at 600 nm, approximately 10⁸ CFU) in a volume of 0.2 to 0.3 ml on three alternating days .

Disease progression should be monitored over extended periods, as H. hepaticus-induced liver pathology develops progressively over months. Colonization levels should be quantified by qPCR in both colon and liver tissues at multiple time points post-infection . Histological analysis should evaluate inflammatory markers, fibrosis progression, and pre-neoplastic changes. Immunohistochemical analysis for markers such as Ki67 and AFP would help assess cellular proliferation and hepatic preneoplasia . Expression analysis of inflammatory cytokines including IL-6, TNF-α, and TGF-β should be conducted using qPCR to assess the impact of nuoK on the inflammatory response .

What is the relationship between nuoK function and HMGB1 signaling in H. hepaticus-induced inflammation?

HMGB1 (High-mobility group box-1) is a damage-associated molecular pattern molecule implicated in H. hepaticus-induced inflammation and hepatic preneoplasia . To investigate the relationship between nuoK and HMGB1 signaling, researchers should compare HMGB1 localization, expression, and release in wild-type versus nuoK mutant H. hepaticus infections.

Immunohistochemical analysis should be used to assess HMGB1 localization in hepatocytes and immune cells . The mRNA and protein levels of HMGB1 should be quantified using qPCR and Western blotting, respectively . Serum HMGB1 levels should be measured using ELISA to determine if nuoK affects HMGB1 release from damaged hepatocytes . Additionally, the activation of downstream signaling pathways including MAPK (Erk1/2 and p38) and Stat3 should be assessed by measuring phosphorylation levels of these proteins . Comparative analysis between wild-type and nuoK mutant infections would elucidate whether nuoK modulates the HMGB1-mediated inflammatory response during H. hepaticus infection.

How do oxygen tension and oxidative stress affect nuoK expression and function?

The expression and function of nuoK likely respond to environmental oxygen levels and oxidative stress conditions. To investigate this relationship, researchers should culture H. hepaticus under varying oxygen concentrations (0-6% O₂) and in the presence of oxidative stress inducers .

Expression analysis should be conducted using qRT-PCR and Western blotting to quantify nuoK mRNA and protein levels under different conditions. Chromatin immunoprecipitation (ChIP) assays could identify transcription factors regulating nuoK expression in response to oxidative stress. Additionally, researchers should measure quinone reductase activity under varying oxygen tensions to determine how environmental conditions affect enzyme function . Comparison with other oxidative stress response genes, such as those encoding superoxide dismutase, would provide insights into the coordinated regulation of the oxidative stress response network in H. hepaticus .

What is the evidence for H. hepaticus presence in human clinical samples?

H. hepaticus has been detected in human bile samples using nested PCR, in situ hybridization, and Western blot analysis . In a study of 126 bile samples from patients with various hepatobiliary diseases, H. hepaticus was detected in 40 samples (32%) when considering positivity by at least one of three detection methods . The breakdown of detection methods showed:

Method(s)Number of positive samples (%)
PCR16 (12.7)
In situ hybridization25 (19.8)
Western blotting17 (13.5)
Double positive with PCR and In situ10 (7.9)
Double positive with PCR and WB4 (3.1)
Double positive with in situ and WB7 (5.6)
Triple positive with PCR, in situ, and WB2 (1.6)
Positive with at least one method40 (32)

Importantly, patients with cholelithiasis (41%) and cholecystitis with gastric cancer (36%) had significantly higher prevalence of H. hepaticus infection compared to patients with other diseases (p = 0.029) . These findings suggest potential clinical relevance of H. hepaticus in human hepatobiliary diseases, though more research is needed to establish causality.

How might nuoK function as a potential therapeutic target for H. hepaticus-associated diseases?

The essential role of nuoK in electron transport and oxidative stress response makes it a potential therapeutic target for H. hepaticus-associated diseases. To evaluate its therapeutic potential, researchers should first confirm whether nuoK is essential for bacterial survival or virulence through conditional knockout studies. If nuoK proves to be a viable target, high-throughput screening of compound libraries could identify inhibitors specific to the bacterial enzyme without affecting human homologs.

Candidate inhibitors should be evaluated for their ability to suppress H. hepaticus growth in vitro, particularly under conditions that induce oxidative stress . In vivo efficacy studies should assess whether inhibitors can reduce bacterial colonization and ameliorate disease progression in mouse models . Pharmacokinetic and pharmacodynamic studies would determine optimal dosing regimens. Additionally, combination therapies targeting both nuoK and other critical bacterial processes could be evaluated for synergistic effects, potentially reducing the risk of resistance development.

What are common challenges in cultivating H. hepaticus for recombinant protein studies?

H. hepaticus cultivation presents several challenges due to its microaerophilic nature and fastidious growth requirements. The bacterium requires specialized growth conditions with reduced oxygen levels (optimal range below 6% O₂) . Standard cultivation protocols involve growing H. hepaticus on solid media for 48 hours before harvesting and resuspending in appropriate broth media .

Common technical issues include contamination with faster-growing organisms, difficulty in achieving consistent growth across batches, and loss of viability during long-term storage. Researchers should monitor cultures carefully, optimize media composition, and develop reliable cryopreservation protocols. For recombinant protein expression, it's often more practical to express H. hepaticus proteins in heterologous systems such as E. coli, though care must be taken to ensure proper folding and function of the expressed proteins .

How can researchers address challenges in detecting H. hepaticus in clinical and experimental samples?

Detection of H. hepaticus presents challenges due to its low abundance and potential coccoid forms in clinical samples . Cultivation attempts from clinical samples are often unsuccessful, necessitating molecular detection methods . To maximize detection sensitivity, researchers should employ a combination of nested PCR, in situ hybridization, and immunological methods, as each technique alone may miss a significant portion of positive samples .

For PCR-based detection, primers targeting conserved regions of the 16S rRNA gene are recommended, with sequencing confirmation of PCR products to ensure specificity . For in situ hybridization, researchers should be aware that H. hepaticus may appear coccoid rather than spiral in clinical samples . Western blot analysis using specific antibodies provides an additional detection method, though cross-reactivity with related Helicobacter species should be considered . In experimental settings, quantitative PCR provides a reliable method for measuring bacterial load in infected tissues over time .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.