Recombinant Helicobacter pylori 36 kDa antigen

Shipped with Ice Packs
In Stock

Description

Definition and Background

The "Recombinant Helicobacter pylori 36 kDa antigen" refers to a protein fragment of Helicobacter pylori produced through recombinant DNA technology . This involves isolating the gene that encodes the 36 kDa antigen, inserting it into a vector, and expressing it in a host organism such as E. coli or yeast . The recombinant protein is then purified for research or diagnostic use .

Production and Purification

To produce recombinant H. pylori antigens, the following steps are generally followed:

  1. Gene Isolation: The gene encoding the target antigen is isolated from the H. pylori genome .

  2. Cloning: The gene is inserted into a plasmid vector .

  3. Expression: The plasmid is introduced into a host organism (e.g., E. coli) for protein production .

  4. Purification: The recombinant protein is isolated and purified using techniques like affinity chromatography .

Diagnostic Potential

Recombinant H. pylori antigens, including the 36 kDa antigen, have shown promise in the diagnosis of H. pylori infections . Studies have indicated that these antigens can be recognized by antibodies in the sera of infected patients, making them useful in serological assays .

  • Sensitivity and Specificity: A study testing H. pylori recombinant proteins with a molecular weight of 26 kDa (Mr26000) showed a sensitivity of 94.0%, a specificity of 97.0%, and an accuracy of 94.5% when used in a colloid gold kit for H. pylori detection .

  • Disease Association: Research indicates a possible link between serological responses to an H. pylori outer membrane protein antigen with a molecular weight of 18 kDa (Mr18000) and the risk of gastric cancer .

Vaccine Development

Recombinant antigens are being explored as potential vaccine candidates against H. pylori . By using specific antigenic regions, researchers aim to stimulate an immune response that can protect against infection .

  • Multi-Epitope Constructs: A study combined antigenic regions of UreB and FlaA into a recombinant multi-epitope protein (rFlaA-UreB). The results showed that the new protein had high antigenicity and could stimulate the immune response, suggesting its potential use in vaccines .

Research Findings

Study FocusAntigen(s)Key Findings
Multi-epitope antigen developmentrFlaA-UreB (recombinant FlaA and UreB)The recombinant protein had high antigenicity and stimulated the immune response. It can be effectively used for vaccines and as a diagnostic antigen for H. pylori infections in different kits .
Diagnostic kit evaluationRecombinant proteins with Mr26000 and Mr18000The colloid gold kit with Mr26000 protein can be used as a conventional examination method. A significant association was found between the serologic response to Mr18000 OMP antigen and malignant outcome .
Recombinant UreG proteinrUreGShowed high reactivity with H. pylori patients’ sera and no reactivity with most other sera, as well as good immunogenicity in mice. Thus, rUreG is a promising candidate for the diagnosis of H. pylori .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HP_1488; 36 kDa antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
HP_1488
Target Protein Sequence
MSNSMLDKNKAILTGGGALLLGLIVLFYLAYRPKAEVLQGFLEAREYSVSSKVPGRIEKV FVKKGDHIKKGDLVFSISSPELEAKLAQAEAGHKAAKALSDEVKRGSRDETINSARDVWQ AAKSQATLAKETYKRVQDLYDNGVASLQKRDEAYAAYESTKYNESAAYQKYKMALGGASS ESKIAAKAKESAALGQVNEVESYLKDVKATAPIDGEVSNVLLSGGELSPKGFPVVLMIDL KDSWLKISVPEKYLNEFKVGKEFEGYIPALKKSTKFRVKYLSVMGDFATWKATNNSNTYD MKSYEVEAIPLEELENFRVGMSVLVTIKP
Uniprot No.

Target Background

Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are commonly used for recombinant H. pylori antigen production?

Recombinant H. pylori antigens, including the 36 kDa antigen, are typically expressed using E. coli-based expression systems. The process generally involves cloning the coding sequence into expression vectors such as pET systems that allow for IPTG-inducible expression. The standard procedure includes:

  • PCR amplification of the target gene from H. pylori genomic DNA

  • Restriction digestion and ligation into expression vectors

  • Transformation into competent E. coli cells

  • Induction of protein expression using IPTG when bacterial culture reaches OD600 of 0.5

  • Cell harvest and lysis to extract the recombinant protein

The proteins may be expressed in both soluble and insoluble forms, as demonstrated with the UreG protein, which requires optimization of expression conditions for maximum yield .

How is the purity of recombinant H. pylori antigens assessed?

The purity of recombinant H. pylori antigens is typically evaluated through:

  • SDS-PAGE analysis to assess molecular weight and purity

  • Western blot analysis using specific antibodies

  • Mass spectrometry for protein identification and confirmation

  • Size exclusion chromatography to determine homogeneity

For optimal purification, affinity chromatography using nickel nitrilotriacetic acid (Ni-NTA) resin is commonly employed for His-tagged recombinant proteins. This approach allows for selective binding of the His-tagged proteins to the resin while impurities are washed away, followed by elution with imidazole buffer . Purification protocols typically include optimization of buffer conditions, including pH and salt concentration, to maximize protein yield and purity.

What serological assays are used to evaluate recombinant H. pylori antigen reactivity?

Several serological assays are employed to evaluate the reactivity of recombinant H. pylori antigens with patient sera:

  • Western blot analysis using HRP-conjugated anti-human IgG and IgA antibodies

  • Enzyme-linked immunosorbent assay (ELISA)

  • Immunofluorescence assays

  • Immunoprecipitation techniques

In western blot analysis, recombinant antigens are typically transferred to nitrocellulose membranes and probed with patient sera followed by detection with HRP-conjugated secondary antibodies. Studies have shown that the combination of IgG and IgA western blots can significantly improve the detection sensitivity, with combined reactivity reaching 83.3% for some antigens .

What is the relationship between antibody response and protection against H. pylori?

The relationship between antibody response and protection against H. pylori is complex and not entirely straightforward. Contrary to conventional understanding, antibodies may actually be detrimental to eliminating H. pylori bacteria and can impair gastric inflammatory responses. Studies using B cell-deficient (μMT) mice have demonstrated that:

  • Initial colonization with H. pylori is normal in μMT mice

  • After 8 weeks, μMT mice clear most bacteria, concurrent with severe gastritis development

  • Wild-type mice exhibit extensive bacterial colonization and only mild gastric inflammation

  • T cells appear responsible for gastritis, while antibodies are not involved in causing gastritis

These findings suggest that T cell-mediated immunity, particularly Th1 responses, play a dominant role in protection, whereas antibodies may counteract resistance to infection with H. pylori bacteria .

What methodologies are optimal for screening protective recombinant H. pylori antigens?

The optimal methodology for screening protective recombinant H. pylori antigens involves a multi-faceted approach:

  • Construction of genomic DNA libraries in appropriate expression vectors (e.g., ZAP Express lambda vector)

  • Screening libraries with antisera raised in mice vaccinated with H. pylori or related species (e.g., H. felis) plus adjuvants like cholera toxin

  • Selection of clones producing immunoreactive proteins

  • Sequencing and expression of candidate antigens in E. coli expression systems

  • Purification of recombinant proteins for in vivo testing

  • Challenge studies in mouse models to assess protective efficacy

This approach has successfully identified several protective antigens, including urease and heat shock protein HspB, as well as novel protective antigens . The screening strategy using antisera from mice vaccinated with protective regimens maximizes the possibility of obtaining antigens capable of conferring protection from H. pylori infection.

How do recombinant H. pylori antigens compare with native antigens in immune recognition and protective efficacy?

Recombinant and native H. pylori antigens show both similarities and differences in immune recognition and protective efficacy:

  • Recombinant antigens may lack post-translational modifications present in native proteins

  • Properly folded recombinant proteins can display epitopes similar to native antigens

  • Hyperimmune mice serum against recombinant proteins can recognize both recombinant and native forms

The protective efficacy of recombinant antigens depends on:

  • Proper folding and structural integrity

  • Preservation of critical epitopes

  • Appropriate adjuvant selection

  • Route of administration

  • Host immune response characteristics

What are the molecular mechanisms by which antibodies might impair H. pylori clearance?

Several molecular mechanisms have been proposed to explain how antibodies might impair H. pylori clearance:

  • Neutralization of proinflammatory factors released by the bacterium, dampening inflammation

  • Binding of secretory IgA to bacteria in the gastric lumen, allowing bacteria to evade immune recognition

  • Production of predominantly IgA1 (rather than IgA2) in H. pylori-induced gastritis, which is more susceptible to degradation

  • Suboptimal deposition of IgA and IgG on bacteria, preventing activation of inflammatory responses

  • Binding of antibodies to leukocyte FcγRs with inhibitory function, promoting release of anti-inflammatory cytokines like IL-10

  • Facilitation of bacterial adherence to the mucus layer covering the gastric epithelium

Research has shown that chronically infected patients develop high titers of specific IgA and IgG in serum and gastric mucosa yet remain infected for life, suggesting that antibodies may counteract resistance to infection . Understanding these mechanisms is crucial for developing effective vaccines that promote protective rather than counterproductive immune responses.

What methodological challenges exist in evaluating the diagnostic potential of recombinant H. pylori antigens?

Evaluating the diagnostic potential of recombinant H. pylori antigens presents several methodological challenges:

  • Selection of appropriate control groups:

    • Healthy individuals with no history of gastric disorders

    • Patients with gastrointestinal complaints but H. pylori culture negative

    • Patients with other diseases

  • Standardization of antigen preparation:

    • Consistency in expression systems

    • Purification protocols that maintain antigenic epitopes

    • Protein quantification and stability assessment

  • Optimization of detection methods:

    • Selection of appropriate antibody isotypes (IgG vs. IgA)

    • Determination of optimal cutoff values

    • Cross-validation with established diagnostic methods

  • Assessment of cross-reactivity:

    • Testing against sera from patients with related infections

    • Evaluation of potential autoreactivity

    • Specificity determination across different H. pylori strains

Studies evaluating the diagnostic potential of recombinant UreG found 70% reactivity with anti-human IgG and 60% with anti-human IgA, with combined reactivity of 83.3% . These values must be compared with established diagnostic tests and validated across diverse patient populations to determine true clinical utility.

What experimental approaches can resolve discrepancies in protective efficacy reported for various recombinant H. pylori antigens?

Resolving discrepancies in protective efficacy of recombinant H. pylori antigens requires systematic experimental approaches:

  • Standardized animal models:

    • Use of consistent H. pylori strains for challenge

    • Standardized protocols for immunization and challenge

    • Uniform methods for assessing bacterial colonization

  • Comparative testing:

    • Side-by-side testing of multiple antigens in the same experimental setting

    • Evaluation of different adjuvant formulations

    • Testing of antigen combinations versus individual antigens

  • Mechanistic studies:

    • Characterization of immune responses (T-cell, B-cell, cytokine profiles)

    • Assessment of gastric pathology and correlation with protection

    • Investigation of local mucosal immune responses

  • Cross-laboratory validation:

    • Replication of key findings across multiple research groups

    • Meta-analysis of published data

    • Development of standard reference antigens and protocols

  • Advanced immunological analysis:

    • Single-cell technologies to characterize immune cell populations

    • Systems biology approaches to identify correlates of protection

    • Long-term follow-up studies to assess durability of protection

These approaches can help resolve contradictory findings, such as the observation that B cell-deficient mice clear H. pylori more effectively than wild-type mice, despite the intuitive expectation that antibodies would be protective .

What future research directions should be prioritized for recombinant H. pylori antigen development?

Future research on recombinant H. pylori antigens, including the 36 kDa antigen, should prioritize:

  • Comprehensive epitope mapping to identify immunodominant regions

  • Structure-function studies to optimize antigen design

  • Investigation of novel adjuvant formulations to enhance protective immunity

  • Development of multivalent vaccines incorporating multiple protective antigens

  • Exploration of mucosal delivery systems for improved immune responses

  • Longitudinal studies to assess long-term protection and immunological memory

  • Investigation of strain-specific versus conserved antigenic determinants

  • Development of point-of-care diagnostic tests based on recombinant antigens

  • Understanding the balance between Th1 and Th2 immune responses in protection

  • Elucidation of mechanisms by which antibodies might impair bacterial clearance

The complex relationship between antibody responses and protection against H. pylori infection warrants particular attention, as conventional vaccine approaches may not be optimal if antibodies potentially counteract resistance . Research should focus on identifying immune correlates of protection and developing vaccination strategies that promote beneficial rather than detrimental immune responses.

How can recombinant H. pylori antigens contribute to personalized medicine approaches?

Recombinant H. pylori antigens can contribute to personalized medicine through:

  • Development of diagnostic panels to identify specific H. pylori strains

  • Correlation of antigen recognition patterns with disease outcomes

  • Identification of patient-specific immune response profiles

  • Tailoring of treatment approaches based on antigenic fingerprinting

  • Monitoring of treatment efficacy through serological responses to specific antigens

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.