Recombinant Helicobacter pylori Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Introduction to Helicobacter pylori and Bacterial Lipoproteins

Helicobacter pylori is a Gram-negative bacterium that persistently colonizes the human stomach in approximately 50% of the global population, affecting over 4 billion people worldwide . Without antibiotic intervention, H. pylori can persist in the stomach for decades, causing chronic gastric inflammation that may progress to more severe conditions including gastric cancer . The World Health Organization has classified H. pylori as a type I carcinogen due to its significant role in gastric cancer development, which ranks as the third leading cause of cancer-related deaths globally .

Like other Gram-negative bacteria, H. pylori possesses lipoproteins as crucial components of its cell envelope. These lipoproteins serve numerous essential cellular functions including nutrient uptake, secretion, cell wall integrity maintenance, and act as important virulence factors in pathogenic bacteria . The biosynthesis of bacterial lipoproteins occurs through a post-translational modification process involving the covalent attachment of lipids, which is catalyzed by three integral membrane enzymes in a sequential manner .

Lipoprotein Biosynthesis Pathway and the Role of Lnt

The production of mature bacterial lipoproteins involves a three-step enzymatic process that begins in the cytoplasm and concludes at the cell membrane. This pathway consists of the following sequential steps:

  1. Prolipoprotein diacylglyceryl transferase (Lgt) adds a diacylglyceride to the sulfhydryl group of the conserved cysteine residue in the pre-prolipoprotein .

  2. Prolipoprotein signal peptidase (LspA, also known as signal peptidase II) cleaves the signal peptide, leaving the diacylated cysteine as the amino-terminal residue of the apolipoprotein .

  3. Apolipoprotein N-acyltransferase (Lnt) adds a third acyl chain to the terminal amine of the acylated cysteine, resulting in the mature, triacylated lipoprotein .

This final N-acylation step catalyzed by Lnt is unique to Gram-negative bacteria and represents a crucial difference in lipoprotein processing between Gram-positive and Gram-negative organisms . The reaction catalyzed by Lnt is proposed to proceed via a 2-step ping-pong mechanism . In the first step, the enzyme facilitates acyl transfer from a phospholipid substrate to create a thioester linkage on the active site cysteine. In the second step, the acyl chain is transferred from this cysteine to the N-terminal cysteine of the lipoprotein .

Production and Characterization of Recombinant Lnt

The production of recombinant Lnt typically involves expressing the enzyme in a suitable host system and then purifying it for further study. Though specific protocols for H. pylori Lnt are not detailed in the available literature, approaches used for other bacterial species provide insights into potential methodologies.

Recombinant Lnt from E. coli (LntEco) and Pseudomonas aeruginosa (LntPae) have been successfully produced for analysis in detergent micelles . Various strategies have been employed to capture the enzyme in different catalytic states. One approach involves creating mutants where the catalytic cysteine is replaced by either alanine (resulting in an inactive enzyme) or serine (resulting in an enzyme with low activity) . Another approach uses covalent modification at the catalytic cysteine with compounds such as tetradecyl-1-isothiocyanate (TITC) .

Functional characterization of recombinant Lnt can be performed using various techniques, including thin-layer chromatography (TLC) and native mass spectrometry (MS) . For instance, the first step of the Lnt reaction can be monitored using specially labeled phospholipid substrates, such as nitrobenzoxadiazole (NBD)-labeled phosphatidylethanolamine (PE) . Similarly, the second step of the reaction can be tracked using fluorescent lipopeptide substrates .

Role of Lnt in H. pylori Pathogenesis

The requirement for Lnt during colonization appears to be related to the role of lipoprotein acylation in modulating the host immune response. Bacterial lipoproteins are recognized by Toll-like receptor 2 (TLR2), a pattern recognition receptor of the innate immune system . The number of acyl chains on lipoproteins impacts the intensity of the TLR2 response, with different acylation patterns triggering varying inflammatory responses.

Table 1: Comparison of Wild-type vs. Δlnt Mutant H. pylori Characteristics

CharacteristicWild-type H. pyloriΔlnt Mutant H. pyloriComplemented Mutant
In vitro growth rateNormalNormalNormal
Acid sensitivityNormalNormalNormal
Antibiotic sensitivityNormalNormalNormal
Lipoprotein acylationTriacylatedDiacylatedTriacylated
TLR2 response inductionModerateRobustModerate
Colonization in wild-type miceSuccessfulUnsuccessfulSuccessful
Colonization in Tlr2-/- miceSuccessfulUnsuccessfulSuccessful

Studies have demonstrated that lipoproteins purified from an lnt mutant H. pylori strain induce a more robust TLR2 response in both TLR reporter cell lines and primary human gastric epithelial cells compared to lipoproteins from a wild-type strain . Differential gene expression analysis indicated that the diacylated lipoprotein from the lnt mutant triggered a heightened inflammatory response through TLR2 signaling .

In vitro and In vivo Studies of H. pylori Lnt

Extensive research has examined the role of Lnt in H. pylori both in laboratory settings and animal models. In vitro studies comparing wild-type, Δlnt mutant, and complemented mutant H. pylori strains have shown no significant differences in growth rates or sensitivities to acid or antibiotic stress . This confirms that Lnt is not essential for the basic physiology of H. pylori under laboratory conditions.

The inability of the Δlnt mutant to colonize even Tlr2-/- mice suggests that the requirement for Lnt in colonization extends beyond simply modulating the TLR2 response. There may be additional aspects of host-pathogen interaction or bacterial physiology in the gastric environment that require properly acylated lipoproteins for successful colonization .

Potential Therapeutic Applications Targeting Lnt

The discovery that Lnt is essential for H. pylori colonization identifies lipoprotein synthesis as a promising target for therapeutic intervention . Inhibitors specifically targeting Lnt could potentially prevent or reduce H. pylori colonization, offering a novel approach to treating H. pylori infection.

This finding is particularly significant given the rising concern about antibiotic resistance in H. pylori and the limitations of current treatment regimens. Developing novel antimicrobial agents that target different aspects of H. pylori physiology or pathogenesis could help address these challenges.

Moreover, the fact that Lnt is unique to Gram-negative bacteria and absent in eukaryotes makes it an attractive target for developing selective antimicrobial agents with potentially fewer side effects . Structural studies of Lnt, including those using recombinant enzymes, provide valuable insights for the structure-based design of inhibitors targeting this enzyme .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnt; HP_0180; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-425
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
lnt
Target Protein Sequence
MRLLLFNQNAFLLACMFVSSVYVNAVLDAYAIENPYISITLTSLLAPLSMLAFLKTPRNS AFALGFFVGALLFYWCALSFRYSDFTYLLPLIIVLIALVYGVLFYLLLYFENPYFRLLSF LGSSFIHPFGFDWLVPDSFFSYSVFRVDKLSLGLVFLACIFLSTKPLKKYRIIGVLLLLG ALDFNGFKTSDLKKVGNIELVSTKTPQDLKFDSSYLNDIENNILKEIKLAQSKQKTLIVF PETAYPIALENSPFKAKLEDLSDNIAILIGTLRTQGYNLYNSSFLFSKESVQIADKVILA PFGETMPLPEFLQKPLEKLFFGESTYLYRNAPHFSDFTLDDFTFRPLICYEGTSKPAYSN SPSKIFIVMSNNAWFSPSIEPTLQRTLLKYYARRYDKIILHSANFSTSYILSPSLLGDIL FRKRS
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Apolipoprotein N-acyltransferase (Lnt) in Helicobacter pylori?

Apolipoprotein N-acyltransferase (Lnt) represents the third enzyme in the lipoprotein synthesis pathway in Gram-negative bacteria like H. pylori. Lnt adds a third acyl chain to the terminal amine of the acylated cysteine residue of lipoproteins, resulting in mature triacylated lipoproteins . This post-translational modification is crucial for proper membrane anchoring of lipoproteins, which have important functions in bacterial pathogenesis, including the delivery of virulence factors such as the CagA oncoprotein to mammalian cells . The acylation process ultimately impacts how these lipoproteins interact with host immune receptors, particularly Toll-like receptor 2 (TLR2) .

How does Lnt fit into the complete lipoprotein synthesis pathway in H. pylori?

Lipoprotein synthesis in H. pylori, as in other Gram-negative bacteria, involves a three-step enzymatic process. First, prolipoprotein diacylglyceryl transferase (Lgt) adds a diacylglyceride to the sulfhydryl group of what will become the amino-terminal modified cysteine residue. Second, prolipoprotein signal peptidase (signal peptidase II, LspA) removes the signal peptide, leaving the diacylated cysteine as the amino-terminal residue. Finally, Lnt adds the third acyl chain to the terminal amine of the acylated cysteine, completing the synthesis of the mature triacylated lipoprotein . While Lgt and LspA are essential for H. pylori growth in vitro, interestingly, Lnt is not essential for in vitro growth but is crucial for colonization in vivo .

What structural and functional domains characterize H. pylori Lnt?

H. pylori Lnt contains conserved motifs that are critical for its enzymatic activity. Research has demonstrated that specific amino acid residues are essential for function, particularly those involved in substrate binding and catalysis. While the complete structure has not been fully characterized in the provided search results, it is understood that Lnt functions as an acyltransferase, transferring acyl chains from membrane phospholipids to the amino terminus of diacylated lipoproteins . Like other enzymes involved in ATP-dependent processes, functional Lnt likely depends on conserved motifs that facilitate proper protein folding and catalytic activity.

What are the most effective methods for expressing and purifying recombinant H. pylori Lnt?

For studying H. pylori Lnt, researchers have employed several effective approaches to express and purify the recombinant protein. One successful method involves the creation of tagged versions of the protein, such as the HA-tagged constructs described in the literature . Expression systems typically utilize complementation approaches wherein the gene is cloned into expression vectors and transformed into H. pylori strains with conditional or deleted endogenous lnt. Purification commonly employs affinity chromatography based on the introduced epitope tags, allowing for specific isolation of the recombinant protein . When designing expression systems, researchers should consider potential toxicity issues, as overexpression of membrane proteins can sometimes inhibit bacterial growth, necessitating the use of inducible promoters for controlled expression.

How can researchers effectively generate and validate lnt knockout mutants in H. pylori?

To generate lnt knockout mutants in H. pylori, researchers typically employ homologous recombination techniques. The process involves constructing plasmids containing antibiotic resistance markers flanked by sequences homologous to regions surrounding the lnt gene. After transformation into H. pylori, selection on appropriate antibiotic-containing media allows for isolation of recombinants in which the endogenous lnt has been replaced or disrupted . Validation of these mutants should include PCR confirmation of the genetic alteration, sequencing to verify the mutation, and complementation studies to confirm that any observed phenotypes are specifically due to lnt deletion. Western blotting can verify the absence of Lnt protein, while mass spectrometry of purified lipoproteins from the mutant strain can confirm the absence of triacylated lipoproteins, demonstrating the functional consequence of lnt deletion .

What analytical techniques are best suited for studying Lnt enzymatic activity and substrate specificity?

Several analytical techniques are valuable for characterizing Lnt enzymatic activity and substrate specificity. Gas chromatography-mass spectrometry (GC-MS) has been effectively used to analyze the fatty acid methyl esters prepared from purified lipoproteins, allowing researchers to determine the acyl composition of lipoprotein modifications . This approach revealed that H. pylori lipoproteins contain primarily C16:0 and C18:0 fatty acids, contrasting with membrane phospholipids that contain mainly C14:0 and C19:0 cyclopropane-containing fatty acids . Additionally, affinity purification-mass spectrometry has been employed to identify protein-protein interactions, which can provide insights into the functional partners of Lnt in the lipoprotein processing pathway . For direct measurement of Lnt activity, in vitro assays using purified enzyme and defined substrates can quantify the transfer of labeled acyl chains from donor phospholipids to acceptor lipoproteins.

How does the absence of Lnt affect H. pylori colonization and virulence in vivo?

Despite Lnt not being essential for H. pylori growth in vitro, it plays a critical role in colonization in vivo. Studies have shown that Δlnt mutant strains are unable to colonize mice, while wild-type and complemented mutant strains successfully colonize both wild-type and TLR2-deficient mice . This indicates that proper lipoprotein acylation by Lnt is crucial for H. pylori's ability to establish and maintain infection in the gastric environment. Interestingly, this colonization defect occurs independent of TLR2 signaling, suggesting that the requirement for Lnt in colonization is not simply due to altered immune detection of diacylated versus triacylated lipoproteins . The precise mechanism by which Lnt-dependent lipoprotein triacylation enables colonization remains to be fully elucidated but may involve proper localization and function of lipoproteins crucial for adhesion, nutrient acquisition, or stress resistance in the harsh gastric environment.

What is the relationship between Lnt activity and immunogenicity of H. pylori lipoproteins?

The acylation state of lipoproteins significantly impacts their detection by the host immune system, particularly through Toll-like receptor 2 (TLR2). Research has revealed that diacylated lipoproteins from Δlnt mutant H. pylori induce a more robust TLR2 response compared to triacylated lipoproteins from wild-type bacteria . This differential response was demonstrated using both TLR reporter cell lines and primary human gastric epithelial cells. Differential gene expression analysis indicated that lipoproteins from the lnt mutant induced a stronger TLR2-dependent inflammatory response . This suggests that Lnt-mediated triacylation of lipoproteins may actually dampen host immune recognition, potentially contributing to H. pylori's ability to establish persistent infection. The precise molecular interactions between differently acylated lipoproteins and TLR2 (alone or in complex with TLR1 or TLR6) that lead to these differential responses represent an important area for further investigation.

How does Lnt interact with other components of the lipoprotein localization (Lol) system in H. pylori?

H. pylori has a somewhat unconventional Lol system compared to the well-studied E. coli model. In H. pylori, the inner membrane components differ significantly - E. coli utilizes LolC and LolE, whereas H. pylori contains a single inner membrane component, LolF . Recent research has identified an ATP-binding protein HP0179 that functions as a LolD-like protein in H. pylori . Affinity purification-mass spectrometry experiments revealed that this LolD-like protein HP0179 specifically interacts with LolF, forming a complex likely involved in the release of lipoproteins from the inner membrane . While direct interactions between Lnt and the Lol system components haven't been fully characterized, the acylation state of lipoproteins processed by Lnt likely affects their recognition and transport by the Lol system. Understanding these interactions is crucial for comprehending how lipoproteins are sorted and transported to their final destinations in H. pylori.

What are the distinguishing features of the H. pylori Lol system compared to other bacterial species?

The H. pylori Lol system exhibits several distinctive features compared to the canonical E. coli system. In H. pylori, the outer membrane component LolB is not found, and instead of separate LolC and LolE inner membrane components, H. pylori contains a single LolF protein . Additionally, identification of the LolD-like ATPase (HP0179) required biochemical approaches as sequence homology searches failed to identify an obvious homolog . This unconventional arrangement suggests that H. pylori has evolved alternative mechanisms for lipoprotein localization. Another important distinction is that while Lnt is essential in bacteria containing LolC and LolE (like E. coli), it appears to be nonessential for in vitro growth in bacteria containing LolF, such as H. pylori . These differences indicate that H. pylori's adaptation to its unique gastric niche has involved significant modifications to its lipoprotein processing and localization systems, which may contribute to its remarkable ability to establish persistent infections.

How can researchers experimentally determine the interaction network of the H. pylori Lol system and Lnt?

To elucidate the interaction network between Lnt and the Lol system, researchers have successfully employed affinity purification coupled with mass spectrometry. This approach was used to identify LolF and HP0179 as interaction partners, confirming the composition of the Lol complex in H. pylori . For studying Lnt interactions, similar epitope tagging strategies could be applied, using carefully designed tags that minimally impact protein function. Complementary approaches include bacterial two-hybrid systems or in vitro pull-down assays with purified components. Conditional expression systems have proven valuable for studying essential components - for example, researchers engineered H. pylori to conditionally express HP0179 and demonstrated that both the protein itself and its conserved ATP binding and ATP hydrolysis motifs are essential for growth . Site-directed mutagenesis of specific residues can further define interaction interfaces. Additionally, techniques like crosslinking followed by mass spectrometry could capture transient interactions between Lnt and Lol system components during the dynamic process of lipoprotein processing and transport.

Can H. pylori Lnt serve as a target for novel antimicrobial development?

The research evidence strongly suggests that H. pylori Lnt represents a promising target for novel antimicrobial development. Although Lnt is not essential for in vitro growth, it is absolutely required for colonization in vivo, as demonstrated by the inability of Δlnt mutant strains to colonize mice . This essential role in the infection process makes Lnt an attractive therapeutic target. The divergence between H. pylori Lnt and human enzymes minimizes the risk of off-target effects, potentially allowing for selective inhibition of the bacterial enzyme. Furthermore, the observation that "lnt is essential for H. pylori colonization and identifies lipoprotein synthesis as a target for therapeutic intervention" directly supports this approach. Developing small molecule inhibitors that specifically target Lnt activity could provide a new class of anti-H. pylori agents that prevent colonization rather than killing bacteria outright, potentially reducing the selective pressure for resistance development.

How might variations in Lnt structure and function across H. pylori strains impact therapeutic development?

The development of Lnt-targeted therapeutics must consider potential variations in the enzyme across different H. pylori strains. While the search results don't specifically address strain-to-strain variations in Lnt, H. pylori is known to exhibit significant genetic diversity. Structural and functional variations in Lnt could impact the efficacy of inhibitors across different clinical isolates. To address this challenge, researchers should analyze Lnt sequences from diverse H. pylori strains to identify highly conserved regions that could serve as targets for broad-spectrum inhibitors. Particular attention should be paid to the conservation of the catalytic site and substrate-binding regions. Functional studies comparing Lnt enzymes from different strains could reveal variations in substrate specificity, catalytic efficiency, or inhibitor sensitivity. Additionally, understanding how Lnt variations might correlate with H. pylori virulence, geographic distribution, or antibiotic resistance profiles could inform therapeutic development strategies. Ultimately, a successful Lnt inhibitor would need to target conserved features essential for the enzyme's function across the spectrum of clinically relevant H. pylori strains.

What are the major technical challenges in working with recombinant H. pylori Lnt, and how can researchers overcome them?

Working with recombinant H. pylori Lnt presents several technical challenges. As a membrane-associated enzyme involved in lipid modification, Lnt is likely hydrophobic and may be difficult to express, purify, and maintain in an active state. The search results mention that "efforts to purify recombinantly expressed HP0179" were performed , indicating that similar challenges may exist for Lnt purification. To overcome these obstacles, researchers can employ specialized expression systems designed for membrane proteins, such as those utilizing detergent solubilization or membrane mimetics like nanodiscs or liposomes. Fusion partners that enhance solubility (like MBP or SUMO) may improve expression yields. For activity studies, reconstitution in lipid environments that mimic H. pylori membranes may be necessary to maintain proper folding and function. Additionally, expressing smaller functional domains of Lnt rather than the full-length protein might provide insights into structure-function relationships while circumventing some purification challenges. Expression in host organisms with similar membrane compositions to H. pylori might also preserve enzymatic activity better than heterologous systems like E. coli.

What are the best approaches for studying the effects of Lnt mutations on H. pylori physiology and pathogenesis?

To study how Lnt mutations affect H. pylori physiology and pathogenesis, researchers have successfully employed both in vitro and in vivo approaches. Conditional expression systems have proven valuable, allowing for the study of essential genes by controlling their expression levels . Site-directed mutagenesis targeting specific functional residues, such as those in the Walker A and B motifs required for ATP binding and hydrolysis in the related HP0179 protein, can provide insights into structure-function relationships . For phenotypic characterization, researchers have compared wild-type, Δlnt mutant, and complemented mutant strains in terms of growth rates, stress responses, and colonization abilities . The use of mouse infection models has been particularly informative, revealing that Lnt is essential for colonization despite being dispensable for in vitro growth . To understand the molecular consequences of Lnt mutations, analytical techniques like gas chromatography-mass spectrometry can characterize changes in lipoprotein acylation patterns . Additionally, transcriptomic and proteomic analyses of mutant strains can provide comprehensive insights into how Lnt mutations affect global gene expression and protein profiles in H. pylori.

What are the most promising unexplored areas of research regarding H. pylori Lnt?

Several promising unexplored areas of research regarding H. pylori Lnt warrant further investigation. First, the mechanism by which Lnt-dependent lipoprotein triacylation enables colonization, independent of TLR2 signaling, remains poorly understood . Identifying the specific lipoproteins most affected by Lnt deficiency and their roles in colonization could provide crucial insights. Second, the discrepancy between fatty acid profiles in membrane phospholipids versus lipoproteins suggests unknown mechanisms of fatty acid selectivity in the acylation process . Determining how Lnt selects specific fatty acids and the functional consequences of this selectivity represents an exciting research direction. Third, the structural biology of H. pylori Lnt remains largely unexplored - crystallographic or cryo-EM studies could reveal unique features of the enzyme that explain its functional properties. Fourth, the potential for synergistic targeting of multiple lipoprotein processing enzymes (Lgt, LspA, and Lnt) could be explored for more effective anti-H. pylori strategies. Finally, investigating how environmental factors in the gastric niche influence Lnt activity and expression might reveal adaptation mechanisms employed by H. pylori during colonization and persistence.

How might systems biology approaches enhance our understanding of Lnt's role in H. pylori physiology?

Systems biology approaches offer powerful tools to comprehensively understand Lnt's role in H. pylori physiology. Integration of transcriptomic, proteomic, and metabolomic data from wild-type and Lnt-deficient strains could reveal network-level effects of Lnt activity beyond its direct role in lipoprotein processing. For example, differential gene expression analysis of human gastric epithelial cells treated with lipoproteins from wild-type or Δlnt mutant H. pylori has already provided insights into how acylation states affect host responses . Expanding such analyses to the bacterial side could identify compensatory mechanisms that allow Δlnt mutants to grow in vitro despite being unable to colonize hosts. Network analysis might uncover unexpected connections between Lnt activity and other cellular processes like stress responses, metabolism, or virulence factor regulation. Mathematical modeling of lipoprotein processing and transport pathways could predict system behaviors under different conditions and guide experimental design. Additionally, genome-scale metabolic models incorporating lipoprotein biosynthesis could help explain the selective pressure for maintaining Lnt function in vivo despite its dispensability in vitro. These integrative approaches would complement reductionist studies to provide a more complete understanding of Lnt's role in H. pylori biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.