Recombinant Helicobacter pylori ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Helicobacter pylori ATP-dependent Zinc Metalloprotease FtsH (ftsH)

Recombinant Helicobacter pylori ATP-dependent zinc metalloprotease FtsH (ftsH) is a protein derived from the bacterium Helicobacter pylori, which is known for its role in causing gastric ulcers and gastric cancer. FtsH is a membrane-anchored, ATP-dependent zinc metalloprotease that plays a crucial role in the quality control of membrane proteins by degrading misassembled or damaged proteins, thereby maintaining cellular homeostasis .

Key Features of Recombinant Helicobacter pylori FtsH:

  • Species Origin: Helicobacter pylori (strain ATCC 700392 / 26695) .

  • Protein Length: The FtsH protein in Helicobacter pylori is composed of 632 amino acids .

  • Function: Essential for cell viability, involved in protein quality control, and membrane protein degradation .

Biological Role and Importance

FtsH is crucial for maintaining the integrity of cellular membranes by removing misassembled or damaged proteins. In Helicobacter pylori, FtsH is essential for cell viability, as its disruption leads to loss of viability . Additionally, FtsH plays roles in regulating the turnover of specific proteins involved in stress responses and membrane functions .

Biological Functions:

  • Protein Quality Control: Degradation of misassembled membrane proteins like SecY and subunit a of FoF1-ATPase .

  • Stress Response: Involved in the degradation of heat-shock transcription factors .

Research Findings and Applications

Recent studies have focused on understanding the structural and functional aspects of FtsH proteases across different organisms. In Helicobacter pylori, research has highlighted the importance of FtsH in maintaining cellular homeostasis and its potential as a target for therapeutic interventions .

Research Highlights:

  • Structural Studies: Crystal structures of the ATPase domain have provided insights into nucleotide-dependent domain motions and substrate translocation mechanisms .

  • Therapeutic Potential: Targeting FtsH could offer new avenues for treating infections caused by Helicobacter pylori, especially in the context of increasing antibiotic resistance .

Availability and Use:

  • Quantity: Available in quantities such as 50 µg; other quantities available upon request .

  • Applications: Used in research for studying protein quality control mechanisms and potential therapeutic targets .

Future Directions:

  • Therapeutic Applications: Investigating FtsH as a target for novel antimicrobial therapies.

  • Structural Biology: Further elucidation of the structural dynamics of FtsH to understand its mechanism of action.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
ftsH; HP_1069; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
ftsH
Target Protein Sequence
MKPTNEPKKPFFQSPIILAVLGGILLIFFLRSFNSDGSFSDNFLASSTKNVSYHEIKQLI SNNEVENVSIGQTLIKASHKEGNNRVIYIAKRVPDLTLVPLLDEKKINYSGFSESNFFTD MLGWLMPILVILGLWMFMANRMQKNMGGGIFGMGSAKKLINAEKPNVRFNDMAGNEEAKE EVVEIVDFLKYPERYANLGAKIPKGVLLVGPPGTGKTLLAKAVAGEAHVPFFSMGGSSFI EMFVGLGASRVRDLFETAKKQAPSIIFIDEIDAIGKSRAAGGVVSGNDEREQTLNQLLAE MDGFGSENAPVIVLAATNRPEILDPALMRPGRFDRQVLVDKPDFNGRVEILKVHIKGVKL ANDVNLQEVAKLTAGLAGADLANIINEAALLAGRNNQKEVRQQHLKEAVERGIAGLEKKS RRISPKEKKIVAYHESGHAVISEMTKGSARVNKVSIIPRGMAALGYTLNTPEENKYLMQK HELIAEIDVLLGGRAAEDVFLEEISTGASNDLERATDIIKGMVSYYGMSSVSGLMVLEKQ RNAFLGGGYGSSREFSEKTAEEMDLFIKNLLEERYKHVKQTLSDYREAIEIMVKELFDKE VITGERVREIISEYEVANNLESRLIPLEEQAS
Uniprot No.

Target Background

Function
This recombinant Helicobacter pylori ATP-dependent zinc metalloprotease FtsH functions as a processive, ATP-dependent zinc metallopeptidase, targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is the basic structure and function of H. pylori FtsH?

H. pylori FtsH is a 632-amino-acid protein that displays striking similarity throughout its full length to FtsH proteins identified in other bacteria, including Escherichia coli, Lactococcus lactis, and Bacillus subtilis. It possesses an approximately 200-amino-acid region containing a putative ATPase module that is conserved among members of the AAA protein family. This protein is membrane-bound, as demonstrated by its presence in the membrane fraction of H. pylori . Functionally, FtsH acts as an ATP-dependent zinc metalloprotease involved in protein quality control and regulation of membrane proteins. The protein is essential for H. pylori cell growth, as disruption of the ftsH gene leads to complete loss of bacterial viability .

How is H. pylori FtsH regulated in different environmental conditions?

H. pylori FtsH expression appears to be regulated in response to environmental conditions. While the specific regulatory mechanisms aren't fully detailed in the provided search results, research using recombination-based in vivo expression technology (RIVET) has established methods for identifying H. pylori genes that are induced in response to the host environment compared to laboratory conditions . Such approaches can be applied to understand FtsH regulation. The protein likely responds to stress conditions including pH changes, nutrient availability, and host defense mechanisms encountered in the gastric environment. Experimental approaches to study this regulation include comparing expression levels between in vitro culture and various in vivo models, examining promoter activity under different conditions, and investigating potential regulatory proteins that interact with the ftsH promoter region.

What experimental systems are available for studying recombinant H. pylori FtsH?

Several experimental systems have been successfully employed to study recombinant H. pylori FtsH:

  • E. coli expression systems: H. pylori FtsH has been successfully overexpressed in E. coli, where it reacts immunologically with anti-E. coli FtsH serum . This system allows for protein production and preliminary functional studies.

  • Gene disruption approaches: Researchers have demonstrated that disruption of the ftsH gene leads to loss of viability in H. pylori, establishing its essential role .

  • Co-expression studies: The interaction between H. pylori FtsH and E. coli FtsH has been studied by co-expression in E. coli host cells, revealing that overproduction of both proteins together significantly reduces host cell growth rate .

  • Membrane fraction isolation: Since FtsH is membrane-bound, techniques for isolating the membrane fraction from H. pylori have proven valuable for studying the protein in its native context .

These systems provide complementary approaches for investigating the structure, function, and regulation of H. pylori FtsH, with each offering distinct advantages depending on the specific research question.

What challenges exist in isolating functional recombinant H. pylori FtsH?

Isolating functional recombinant H. pylori FtsH presents several challenges that researchers must address:

  • Membrane protein solubility: As a membrane-bound protein, FtsH can be difficult to solubilize while maintaining its native conformation and activity. Researchers must optimize detergent conditions that effectively extract the protein from membranes without denaturing it.

  • Expression toxicity: Overexpression of H. pylori FtsH together with E. coli FtsH dramatically reduces host cell growth rate , indicating potential toxicity that can limit recombinant protein yields.

  • Preserving enzymatic activity: Maintaining the dual ATPase and protease activities of FtsH during purification requires careful buffer optimization and handling to prevent denaturation or loss of zinc cofactors.

  • Proper folding: Ensuring correct folding of the recombinant protein, especially when expressed in heterologous systems like E. coli, may require optimization of expression conditions including temperature, induction parameters, and potential co-expression with chaperones.

  • Confirmation of functionality: Developing reliable assays to confirm that the recombinant protein maintains both ATPase and protease activities comparable to the native enzyme.

Researchers have addressed these challenges through strategies such as using mild detergents, optimizing expression conditions, and employing affinity tags that can be removed after purification to minimize interference with protein function.

How does the mechanism of H. pylori FtsH differ from other bacterial FtsH proteins?

While H. pylori FtsH shares significant sequence similarity with FtsH proteins from other bacteria, several features distinguish its mechanism:

Understanding these mechanistic differences requires comparative structural analysis, substrate identification studies, and examination of protein-protein interaction networks specific to H. pylori.

What role does FtsH play in H. pylori pathogenesis and colonization?

FtsH likely plays multiple critical roles in H. pylori pathogenesis and colonization, although direct evidence from the provided search results is limited:

  • Essential viability factor: Disruption of the ftsH gene leads to complete loss of viability in H. pylori , indicating its fundamental importance for bacterial survival, which is a prerequisite for colonization.

  • Stress response regulation: As a quality control protease, FtsH likely helps H. pylori adapt to the harsh acidic environment of the stomach by degrading misfolded or damaged proteins resulting from acid stress.

  • Virulence factor regulation: FtsH may regulate the expression or stability of key virulence factors. In other bacterial pathogens, FtsH has been shown to control the levels of various virulence-associated proteins.

  • Host immune evasion: Proper membrane protein homeostasis maintained by FtsH could be critical for presenting the appropriate surface molecules needed to evade host immune responses.

  • Biofilm formation: FtsH might regulate proteins involved in biofilm development, which contributes to H. pylori persistence in the gastric environment.

Research approaches to elucidate these roles would include creating conditional FtsH mutants, identifying FtsH substrates during infection using proteomics, and examining FtsH expression patterns in different stages of colonization and disease development.

How can researchers identify and characterize the substrate specificity of H. pylori FtsH?

Identifying and characterizing the substrate specificity of H. pylori FtsH requires multifaceted approaches:

  • Comparative proteomics:

    • Compare protein profiles between wild-type H. pylori and strains with reduced FtsH activity using conditional mutants

    • Identify proteins that accumulate when FtsH function is compromised, indicating potential substrates

    • Use stable isotope labeling to track protein turnover rates in the presence and absence of functional FtsH

  • In vitro degradation assays:

    • Purify recombinant H. pylori FtsH and test its ability to degrade candidate substrate proteins

    • Analyze degradation kinetics and compare efficiencies between different substrates

    • Investigate the ATP dependence of the degradation process

  • Substrate trapping:

    • Generate catalytically inactive FtsH mutants (e.g., mutations in the zinc-binding site) that can bind but not degrade substrates

    • Use these mutants as "substrate traps" followed by co-immunoprecipitation and mass spectrometry

    • Map the interacting regions to identify recognition motifs

  • Structural biology approaches:

    • Determine the crystal structure of H. pylori FtsH, particularly focused on the substrate-binding domains

    • Use molecular docking and simulation to predict substrate interactions

    • Validate predictions through site-directed mutagenesis of key residues

  • Cross-linking studies:

    • Employ chemical cross-linking coupled with mass spectrometry to capture transient FtsH-substrate interactions

    • Identify contact points between FtsH and its substrates

These approaches collectively would provide a comprehensive understanding of H. pylori FtsH substrate specificity and the molecular mechanisms underlying its function in bacterial physiology and pathogenesis.

What is the relationship between FtsH function and antibiotic resistance in H. pylori?

The relationship between FtsH function and antibiotic resistance in H. pylori represents an important research area with potential therapeutic implications:

  • Membrane protein quality control: As a membrane-bound protease, FtsH likely regulates the composition and integrity of the bacterial membrane, which serves as the first barrier against antibiotics. Alterations in FtsH activity could therefore influence drug permeability and efflux.

  • Stress response coordination: FtsH may play a role in coordinating stress responses when H. pylori encounters antibiotics. In other bacteria, FtsH has been shown to regulate stress response pathways that contribute to antibiotic tolerance.

  • Potential link to clarithromycin resistance: While not directly mentioned in the search results for FtsH specifically, clarithromycin resistance is a significant clinical concern in H. pylori treatment. From search result , we learn about heteroresistance (mixed populations of resistant and susceptible bacteria) to clarithromycin. It would be valuable to investigate whether FtsH activity influences the development or stability of such heteroresistant populations.

  • Potential research approaches:

    • Compare FtsH expression levels between antibiotic-susceptible and resistant H. pylori strains

    • Investigate whether modulating FtsH activity affects minimum inhibitory concentrations of various antibiotics

    • Determine if FtsH regulates the expression or stability of known antibiotic resistance factors

    • Examine the role of FtsH in stress responses induced by antibiotic exposure

    • Study whether FtsH influences mutation rates or horizontal gene transfer, which could affect the acquisition of resistance genes

A data table summarizing hypothetical relationships between FtsH and different antibiotics might include:

Antibiotic ClassPotential FtsH-Related Resistance MechanismExperimental Approach
Macrolides (e.g., clarithromycin)Regulation of ribosome composition or rRNA methylationMeasure ribosomal protein turnover in FtsH-depleted cells
β-lactamsMaintenance of cell wall synthesis machineryCompare PBP stability and regulation in FtsH mutants
FluoroquinolonesRegulation of DNA gyrase or topoisomerase IV levelsAssess DNA repair protein turnover in FtsH-depleted cells
MetronidazoleModulation of redox-related proteinsMeasure stability of oxygen-sensitive proteins in FtsH mutants

What are the optimal conditions for expressing and purifying recombinant H. pylori FtsH?

Optimizing expression and purification of recombinant H. pylori FtsH requires careful consideration of multiple parameters:

  • Expression system selection:

    • E. coli BL21(DE3) or derivatives are commonly used for initial attempts

    • Consider specialized strains designed for membrane protein expression (e.g., C41/C43)

    • For difficult cases, homologous expression in H. pylori may preserve native folding but yields lower protein amounts

  • Expression construct design:

    • Include affinity tags (His6, FLAG, or Strep) preferably at the C-terminus to minimize interference with membrane insertion

    • Consider fusion partners that enhance solubility (e.g., MBP, SUMO)

    • Include a protease cleavage site for tag removal after purification

  • Culture conditions optimization:

    • Reduce expression temperature to 16-20°C after induction to slow protein production and improve folding

    • Use lower inducer concentrations (0.1-0.5 mM IPTG) for gentler induction

    • Supplement media with zinc (10-50 μM ZnSO4) to ensure metalloprotease domain metallation

    • Consider auto-induction media for gradual protein expression

  • Membrane extraction:

    • Isolate membrane fractions through differential centrifugation

    • Test different detergents for solubilization (start with milder detergents like DDM, LMNG, or CHAPS)

    • Optimize detergent:protein ratios to prevent aggregation while effectively solubilizing the protein

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) for initial capture

    • Size exclusion chromatography to separate aggregates and ensure homogeneity

    • Consider ion exchange chromatography as an additional purification step

  • Protein quality assessment:

    • Verify protein identity through Western blotting with anti-FtsH antibodies

    • Confirm ATPase activity using colorimetric phosphate release assays

    • Assess protease activity using model substrates

    • Evaluate protein stability through thermal shift assays

    • Check for proper oligomerization (typically hexameric) using size exclusion chromatography and/or native PAGE

Based on the search results, H. pylori FtsH has been successfully overexpressed in E. coli and detected immunologically with anti-E. coli FtsH serum , demonstrating the feasibility of heterologous expression.

How can researchers develop assays to measure the dual ATPase and protease activities of H. pylori FtsH?

Developing robust assays to measure both ATPase and protease activities of H. pylori FtsH is essential for functional characterization:

  • ATPase activity assays:

    • Malachite green phosphate assay: Measures inorganic phosphate released during ATP hydrolysis

    • Coupled enzyme assay: Links ATP hydrolysis to NADH oxidation through pyruvate kinase and lactate dehydrogenase

    • Radioactive [γ-32P]ATP assay: Tracks the release of labeled phosphate with high sensitivity

    • Optimization parameters: Temperature (typically 37°C), pH (range 6.5-8.0), divalent cation concentration (Mg2+, Zn2+)

  • Protease activity assays:

    • Fluorogenic peptide substrates: Short peptides conjugated to fluorophore-quencher pairs that fluoresce upon cleavage

    • Model protein substrates: Known FtsH substrates from other bacteria (e.g., σ32, λcII) labeled with fluorescent tags

    • FRET-based assays: Design substrates with donor-acceptor fluorophore pairs that change emission upon proteolysis

    • SDS-PAGE analysis: Monitor the degradation of protein substrates over time

  • Integrated dual-activity assays:

    • ATP-dependent proteolysis: Compare degradation rates of substrates with and without ATP

    • ATPase activity in the presence of substrates: Measure how substrate binding affects ATP hydrolysis rates

    • Mutational analysis: Compare activities of wild-type FtsH with mutants affecting either ATPase (Walker A/B mutations) or protease (zinc-binding site mutations) functions

  • Controls and validation:

    • Negative controls: Heat-inactivated enzyme, addition of EDTA (chelates zinc), addition of ATPase inhibitors

    • Positive controls: Other well-characterized AAA+ proteases

    • Substrate specificity controls: Unrelated proteins that should not be degraded

  • Data analysis approaches:

    • Determine kinetic parameters (Km, Vmax) for both ATPase and protease activities

    • Assess the coupling ratio between ATP hydrolysis and proteolysis

    • Evaluate the effects of different conditions (pH, temperature, salt) on both activities

Example data table for optimizing ATPase activity assay conditions:

Buffer SystempHTemperature (°C)Mg2+ (mM)Zn2+ (μM)Relative ATPase Activity (%)
Tris-HCl7.03751065
Tris-HCl7.53751080
HEPES7.03751075
HEPES7.537510100
HEPES7.542510110
HEPES7.537101095
HEPES7.53755085

What genetic approaches can be used to study FtsH function in H. pylori given that it's an essential gene?

Studying essential genes like ftsH in H. pylori requires specialized genetic approaches that allow functional analysis without completely eliminating the protein:

Example experimental workflow:

  • Create a construct where the native ftsH promoter is replaced with a tetracycline-responsive promoter

  • Integrate this construct into the H. pylori chromosome

  • Validate that FtsH expression depends on tetracycline concentration

  • Identify the minimal tetracycline concentration required for survival

  • Perform experiments at tetracycline concentrations that allow partial FtsH depletion

  • Monitor changes in growth, morphology, stress response, and virulence factor expression under these conditions

How can in vivo expression technology be adapted to study FtsH regulation in the host environment?

Recombination-based in vivo expression technology (RIVET) can be adapted to study FtsH regulation in the host gastric environment based on the methodologies described in search result :

  • RIVET system adaptation for ftsH:

    • Create a gene fusion between the ftsH promoter region and a reporter gene such as tnpR (resolvase)

    • Integrate this construct into the H. pylori genome

    • Include a selectable marker (e.g., Km resistance) flanked by resolvase recognition sites (res1)

    • When the ftsH promoter is activated, TnpR is expressed and excises the selectable marker

  • Experimental design for host environment studies:

    • Infect animal models (typically mice) with the engineered H. pylori strain

    • After a defined colonization period (e.g., 2 weeks), recover bacteria from different gastric regions

    • Measure the percentage of bacteria that have lost the selectable marker as an indicator of ftsH promoter activation

    • Compare these results with in vitro activation levels to identify host-specific regulation

  • Controls and validation:

    • Include strains with constitutively active promoters as positive controls

    • Use promoters known to be inactive in the host as negative controls

    • Verify that the RIVET system doesn't affect normal H. pylori colonization patterns

  • Advanced applications:

    • Create truncated or mutated versions of the ftsH promoter to identify specific regulatory elements responsive to host signals

    • Combine with deletion of potential regulators to identify factors controlling ftsH expression

    • Apply the system in different infection models (acute vs. chronic) to understand temporal regulation

  • Data collection and analysis:

    • Quantify the percentage of resolution (loss of selectable marker) under different conditions

    • Correlate resolution rates with host factors (pH, inflammation, nutrient availability)

    • Apply statistical analysis to identify significant differences between conditions

Example workflow based on search result :

  • Construct H. pylori RIVET strains containing the ftsH promoter region

  • Screen the strains in parallel by infecting mice with a mixture of RIVET library strains

  • Allow infections to persist for 2 weeks

  • Harvest mouse stomachs and plate homogenates on selective media

  • Replica plate colonies on media with and without the selective marker

  • Calculate the percentage of colonies that have lost the marker as a measure of in vivo promoter activation

This approach would provide valuable insights into how ftsH expression is regulated in response to the host environment, potentially identifying signals that modulate this essential protein's expression during infection.

What are the most promising therapeutic applications targeting H. pylori FtsH?

The essential nature of FtsH for H. pylori viability makes it an attractive target for novel therapeutic approaches, though this must be balanced with considerations of specificity to avoid targeting human homologs:

  • Small molecule inhibitors:

    • Develop compounds that specifically inhibit H. pylori FtsH ATPase or protease activity

    • Target unique structural features that distinguish it from human AAA+ proteases

    • Design allosteric inhibitors that prevent hexamerization or substrate binding

  • Peptide-based inhibitors:

    • Create peptides that mimic FtsH substrates but resist degradation, thereby competitively inhibiting the enzyme

    • Design peptides that disrupt higher-order assembly of FtsH complexes

    • Develop cell-penetrating antimicrobial peptides that specifically target FtsH function

  • Combination therapies:

    • Identify synergistic interactions between FtsH inhibitors and existing antibiotics

    • Explore whether FtsH inhibition could reverse clarithromycin resistance or heteroresistance

    • Develop dual-targeting approaches that simultaneously inhibit FtsH and other essential H. pylori proteins

  • Essential cofactor targeting:

    • Design zinc chelators with specificity for the FtsH active site

    • Develop compounds that interfere with ATP binding or hydrolysis specifically in FtsH

  • Delivery strategies:

    • Create acid-resistant delivery systems to protect therapeutics in the gastric environment

    • Develop H. pylori-specific targeting mechanisms to enhance drug delivery efficiency

The therapeutic potential is particularly significant given the rising rates of antibiotic resistance in H. pylori and the challenges this presents for eradication therapy . The essential nature of FtsH, demonstrated by the non-viability of ftsH knockout strains , suggests that resistance to FtsH-targeting therapeutics might be less likely to develop through simple loss-of-function mutations.

What key questions remain unanswered in H. pylori FtsH research?

Despite progress in understanding H. pylori FtsH, several critical questions remain unanswered that warrant further investigation:

  • Structural biology questions:

    • What is the complete three-dimensional structure of H. pylori FtsH?

    • How does substrate recognition occur, and what structural features determine specificity?

    • What conformational changes occur during the ATPase and protease reaction cycle?

    • How does the membrane-embedded domain contribute to function?

  • Physiological role questions:

    • What is the complete set of natural substrates for H. pylori FtsH?

    • How does FtsH activity change in response to different stress conditions encountered in the host?

    • What is the relationship between FtsH and other quality control systems in H. pylori?

    • How does FtsH contribute to biofilm formation and the development of persistent infections?

  • Regulatory questions:

    • What transcriptional and post-translational mechanisms regulate FtsH levels and activity?

    • Is FtsH expression or activity modulated during different stages of infection?

    • How does FtsH activity correlate with virulence factor expression?

    • Do host factors directly interact with or modulate FtsH function?

  • Evolutionary questions:

    • How has H. pylori FtsH evolved compared to other bacterial FtsH proteins?

    • Are there strain-specific variations in FtsH sequence or function that correlate with geographic distribution or disease outcomes?

    • What selective pressures in the gastric environment have shaped FtsH function?

  • Therapeutic development questions:

    • Can specific inhibitors be developed that target H. pylori FtsH without affecting human AAA+ proteases?

    • Would targeting FtsH be effective against antibiotic-resistant strains?

    • What is the potential for resistance development against FtsH-targeting therapeutics?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.