Recombinant Helicobacter pylori ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Helicobacter pylori ATP synthase subunit a (atpB) is a genetically engineered protein produced in Escherichia coli (E. coli). It represents the full-length atpB subunit (1–226 amino acids) of the H. pylori ATP synthase complex, fused to an N-terminal hexahistidine (His) tag for purification . This subunit is a critical component of the membrane-embedded F<sub>O</sub> sector of the ATP synthase, which facilitates proton translocation and energy production in bacterial cells . The ATP synthase complex is essential for oxidative phosphorylation, enabling H. pylori to generate ATP under varying metabolic conditions .

Domain Organization

  • Transmembrane domains: Facilitate proton translocation across the bacterial membrane.

  • His tag: Enables affinity chromatography-based purification .

Production and Purification

ParameterSpecification
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose
Reconstitution0.1–1.0 mg/mL in deionized water; 5–50% glycerol recommended for stability

Functional Insights

  • Role in ATP Synthase Assembly: AtpB forms part of the F<sub>O</sub> sector’s proton channel, interacting with subunits AtpF (b-subunit) and AtpX (b’-subunit) to stabilize the peripheral stalk .

  • Cell Shape Regulation: AtpB co-purifies with cell shape-determining proteins like Csd5 and CcmA, suggesting a secondary role in maintaining H. pylori’s helical morphology .

Protein-Protein Interactions

Interacting ProteinFunctionRelevance to AtpB
MurFPeptidoglycan biosynthesisCo-purifies with AtpB in complexes
CcmACell shape maintenanceLinked to membrane curvature
AtpD (β-subunit)F<sub>1</sub> ATPase activityPart of ATP synthase core structure
Data derived from co-immunoprecipitation assays .

Applications in Research

  • Antibacterial Drug Development: ATP synthase is a target for diarylquinolines, which disrupt mycobacterial energy metabolism . Similar strategies could apply to H. pylori .

  • Structural Studies: Used in SDS-PAGE and crystallography to analyze ATP synthase architecture .

  • Antigen Characterization: Potential use in ELISA for detecting H. pylori infections .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly specify it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please notify us in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; HPAG1_0814; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Helicobacter pylori (strain HPAG1)
Target Names
atpB
Target Protein Sequence
MEHRVFTIANFFSSNHDFITGFFVVLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAI LSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPGFESPTASWSFTLVLALIVFFYY HFEGIRVQGFFKYFAHFAGPVKWLAPFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLI MLLLVPWAVPVAPFMVLFFMGILQAFVFMILTYVYLAGAVLTDEGH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in facilitating the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of H. pylori ATP synthase?

The H. pylori ATP synthase follows the general F₁F₀ structure found in bacteria but with distinctive variations in subunit composition. The complex consists of a membrane-embedded F₀ sector containing the a-subunit (atpB) and a cytoplasmic F₁ catalytic sector. The H. pylori ATP synthase has a unique subunit stoichiometry that differs from the prototypical bacterial synthase, particularly in the peripheral stalk, where instead of a single dimeric b-subunit, there exist additional variations . The core structure includes the α, β, γ, δ, and ε subunits in the F₁ portion, and a, b, and b' subunits in the F₀ portion. The a-subunit (atpB) spans the inner membrane and plays a crucial role in proton translocation.

What are the key functional domains of H. pylori atpB?

The atpB protein (subunit a) of H. pylori ATP synthase consists of 226 amino acids and functions within the inner membrane . This subunit contains transmembrane domains that form part of the proton channel essential for the proton-motive force that drives ATP synthesis. The protein participates in plasma membrane ATP synthesis-hydrolysis coupled proton transport . Unlike soluble components of ATP synthase, atpB is hydrophobic and embedded in the membrane, making its functional characterization challenging without proper expression and reconstitution systems.

How does H. pylori ATP synthase subunit organization differ from other bacterial species?

H. pylori ATP synthase exhibits notable differences from other bacterial ATP synthases. Most significantly, H. pylori possesses both a b-subunit (AtpF) and a b'-subunit (AtpX) . This divergence from the typical bacterial ATP synthase architecture, which usually contains only a dimeric b-subunit, suggests evolutionary adaptations specific to H. pylori's unique ecological niche. These structural differences may influence enzyme assembly, stability, and regulation in the acidic gastric environment where H. pylori resides.

What expression systems are most effective for recombinant H. pylori atpB production?

E. coli expression systems have proven effective for producing recombinant H. pylori atpB. The full-length protein (1-226aa) can be successfully expressed with an N-terminal His-tag in E. coli . When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli if expression levels are suboptimal

  • Selection of appropriate fusion tags (His-tag being common) to facilitate purification

  • Use of specialized E. coli strains optimized for membrane protein expression

  • Induction conditions using IPTG at appropriate concentrations (typically 1 mM)

The expression of membrane proteins like atpB often requires optimization of growth temperature, induction timing, and media composition to prevent formation of inclusion bodies and ensure proper membrane integration.

What purification strategies yield high-quality recombinant atpB protein?

Purification of recombinant atpB requires specialized approaches due to its membrane-associated nature. Effective purification typically involves:

  • Cell lysis using sonication or mechanical disruption

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (e.g., n-dodecyl β-D-maltoside or Triton X-100)

  • Affinity chromatography using the N-terminal His-tag

  • Size exclusion chromatography for further purification

Alternative approaches may include GST-fusion systems similar to those used for other challenging H. pylori proteins, as demonstrated in expression strategies for other recombinant H. pylori proteins . For functional studies, it's critical to maintain the native conformation of atpB during purification by careful selection of detergents and buffer conditions.

How can researchers verify the structural integrity of purified recombinant atpB?

Verification of properly folded recombinant atpB can be accomplished through:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Limited proteolysis to evaluate conformational stability

  • Reconstitution into liposomes followed by proton pumping assays

  • Antibody recognition using conformational antibodies

  • Functional assays measuring ATP synthesis or hydrolysis when assembled with other ATP synthase components

For membrane proteins like atpB, confirmation of proper folding is particularly important as improper folding can significantly impact functional studies and structural analyses.

How is recombinant atpB used in vaccine development research?

While atpB specifically has not been thoroughly investigated as a vaccine candidate, the approach used for other H. pylori antigens provides a framework for such research. Screening approaches that identified protective H. pylori antigens used:

  • Creation of genomic DNA libraries in expression vectors such as ZAP Express lambda vector

  • Screening with antisera from animals vaccinated with H. pylori antigens plus adjuvants

  • Identification of immunoreactive clones followed by sequence analysis

  • PCR amplification and cloning into expression vectors

  • Purification and testing of recombinant proteins for protective efficacy in animal models

Several H. pylori proteins identified through similar approaches demonstrated protective effects in mouse models, suggesting that atpB could be evaluated as a potential vaccine candidate using established methodologies.

What techniques are used to study interactions between atpB and other ATP synthase subunits?

Understanding protein-protein interactions involving atpB requires specialized techniques:

  • Co-immunoprecipitation (Co-IP) assays with tagged versions of atpB and other subunits

  • Crosslinking studies to capture transient interactions

  • Surface plasmon resonance to measure binding kinetics

  • Bacterial two-hybrid systems for in vivo interaction studies

  • Proteomic approaches using mass spectrometry

Similar approaches have been employed successfully for studying interactions between other H. pylori proteins, such as Csd5 with ATP synthase components . These studies revealed that multiple ATP synthase subunits can be co-immunoprecipitated with other proteins, suggesting that similar approaches would be viable for atpB interaction studies.

How can recombinant atpB be used to develop inhibitors targeting H. pylori ATP synthase?

Development of inhibitors targeting H. pylori atpB would follow this general workflow:

  • High-throughput screening assays using purified recombinant atpB

  • Structure-based design informed by molecular modeling or crystallographic data

  • Functional assays measuring impact on ATP synthesis in reconstituted systems

  • Assessment of specificity by comparing effects on H. pylori versus human ATP synthase

  • Evaluation of antimicrobial activity against H. pylori cultures

  • Investigation of resistance development through extended culture experiments

This approach could lead to novel therapeutics targeting the unique features of H. pylori ATP synthase that differ from human mitochondrial ATP synthase, potentially offering selective toxicity.

How does the expression of atpB vary in different H. pylori disease associations?

Proteomic analyses have revealed that ATP synthase subunit expression can vary in different pathological conditions. Specifically, the ATP synthase subunit α was found to be downregulated in H. pylori associated with autoimmune atrophic gastritis (AAG) compared to gastric cancer (GC) . This differential expression suggests that ATP synthase components may play roles in pathogenesis or adaptation to different gastric environments. While this study focused on the α subunit rather than atpB specifically, similar differential expression patterns might exist for atpB across disease conditions. Researchers investigating this question should consider:

  • Comparative proteomics of H. pylori isolates from different disease conditions

  • Transcriptional analysis of atpB expression in various clinical isolates

  • Assessment of post-translational modifications affecting atpB in different conditions

  • Correlation of expression levels with virulence properties

What structural adaptations of atpB may contribute to H. pylori survival in acidic environments?

H. pylori uniquely thrives in the acidic environment of the human stomach, suggesting possible adaptations in its ATP synthase components including atpB. Advanced research questions include:

  • How do the transmembrane domains of atpB compare to those in neutralophilic bacteria?

  • Are there specific amino acid substitutions that enhance proton handling in acidic conditions?

  • Does atpB contribute to maintaining cytoplasmic pH homeostasis through modified proton translocation?

  • How does the interaction between atpB and other F₀ components adapt to function optimally at low pH?

Addressing these questions requires combining structural biology, site-directed mutagenesis, and functional assays in reconstituted systems that mimic the acidic environment H. pylori encounters.

How might recombination events affect atpB genetic diversity across H. pylori strains?

H. pylori exhibits remarkable genetic diversity through recombination mechanisms. While specific recombination involving atpB has not been directly documented, the general principles of recombination in H. pylori suggest potential impacts:

  • Intragenomic recombination between homologous genes might affect atpB sequence and function

  • Horizontal gene transfer between strains could introduce novel atpB variants

  • Recombination events might affect expression through modifications of promoter regions

H. pylori has been shown to undergo frequent recombination between related genes, as exemplified by the babA and babB genes . Similar mechanisms could potentially affect atpB, contributing to strain-specific variations in ATP synthase structure and function.

How does the Walker motif in H. pylori ATP synthase compare to other bacterial ATPases?

While the search results don't provide specific information about Walker motifs in H. pylori ATP synthase, we can draw parallels with other H. pylori ATPases. In the Cagβ ATPase, the Walker A motif (239PTRSGK244) and Walker B motif (D550 and E551) are conserved structural elements required for ATP binding and hydrolysis . ATP synthase likely contains similar conserved motifs, though with sequence variations specific to its function.

For researchers investigating this area, careful sequence alignment of atpB with homologs from other species would reveal conservation patterns in these critical motifs. Mutations in these regions would be expected to significantly impact ATP synthesis activity.

What are the key methodological challenges in studying atpB function in reconstituted systems?

Reconstitution of functional ATP synthase containing atpB presents several technical challenges:

  • Maintaining structural integrity of hydrophobic atpB during purification

  • Ensuring proper orientation during reconstitution into liposomes

  • Assembly of complete ATP synthase complexes with correct stoichiometry

  • Establishing appropriate proton gradients for functional assays

  • Distinguishing ATP synthesis from hydrolysis activities

These challenges can be addressed through careful optimization of detergent selection, reconstitution protocols, and development of specialized assay systems that accurately measure proton-driven ATP synthesis.

How does the oligomeric state of atpB affect ATP synthase function?

The oligomeric state of ATP synthase components is critical for their function. While specific information about atpB oligomerization is not provided in the search results, insights from other ATP-related proteins in H. pylori suggest important considerations:

  • The Cagβ ATPase functions as a dynamic hexameric assembly

  • Oligomerization can significantly impact ATPase activity

  • Protein-protein interactions can regulate oligomeric states

For atpB specifically, researchers should investigate whether it participates in dimer or oligomer formation within the membrane, as ATP synthase components in other organisms have been shown to form higher-order structures that affect their function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.