Recombinant Helicobacter pylori Biopolymer transport protein exbB (exbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Helicobacter pylori Biopolymer Transport Protein exbB

Recombinant Helicobacter pylori biopolymer transport protein exbB (exbB) is a critical protein involved in the transport mechanisms of this gram-negative bacterium, which is known to colonize the gastric mucosa in humans. This protein plays a significant role in the TonB-dependent transport system, which is essential for the uptake of various nutrients, including iron and nickel, from the environment.

Research Findings

Gene Information

The gene encoding this protein is designated as HP_1339 (or HP_1445 in some references). Studies have shown that its expression is regulated by iron availability and growth phases, indicating its adaptive response to environmental changes.

Expression Studies

Research indicates that exbB expression increases under iron starvation conditions, suggesting its role in nutrient acquisition during limiting conditions. For instance, a study found that exbB was one of several genes upregulated in stationary-phase cultures when iron was scarce .

Production and Purification

Recombinant Production

Recombinant exbB is typically produced using an Escherichia coli expression system. The protein can be tagged with a histidine tag for easier purification through affinity chromatography.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
exbB; HP_1339; Biopolymer transport protein ExbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Target Names
exbB
Target Protein Sequence
MGGFSVGMLKDYVDIFVFAVLGVASFLALWFAIERVIFYSKVDLKAYDDIDALNLDLTKN LTILYVIFSNAPYVGLLGTVLGIMVIFYDMGVSGGMDAKTIMVGLSLALKATALGLAVAI PTLIAYNSLLRKSDVLSEKFRIMKK
Uniprot No.

Target Background

Function
ExbB is involved in TonB-dependent, energy-driven transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.
Gene References Into Functions
  1. H. pylori utilizes TonB/ExbB/ExbD for nickel uptake in addition to iron acquisition. PMID: 17238922
Database Links
Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ExbB and what role does it play in Helicobacter pylori?

ExbB is an integral membrane protein that forms part of a three-protein complex (ExbB/ExbD/TonB) in Helicobacter pylori. It functions as a critical component of the energy transduction system that facilitates outer membrane receptor-dependent uptake processes. In H. pylori, this complex is particularly important for acid acclimation and bioenergetics, enabling the bacterium to survive in the harsh acidic environment of the stomach. ExbB contains three transmembrane helices with a large cytoplasmic domain, working alongside ExbD to form a proton channel across the inner membrane . This channel transfers energy from the proton-motive force to power essential transport processes, including the uptake of nutrients and metals like nickel that are crucial for H. pylori survival and virulence .

How does ExbB differ structurally from other bacterial homologs?

ExbB in H. pylori shares fundamental structural characteristics with homologs in other Gram-negative bacteria but exhibits species-specific adaptations. While all ExbB proteins contain three transmembrane segments, some bacterial species like Serratia marcescens possess ExbB proteins with extended N-terminal periplasmic domains of approximately 40 residues that are absent in Escherichia coli and potentially in H. pylori . The ExbB protein forms stable oligomeric complexes, with evidence indicating pentameric arrangements as observed in S. marcescens . The specific arrangement in H. pylori requires further structural elucidation, though it likely resembles the pentameric or hexameric structures observed in other species. These structural differences may reflect adaptations to specific environmental niches and functional requirements of different bacterial pathogens .

What is the genetic organization of exbB in H. pylori?

In H. pylori, the exbB gene (HP1339 in the 26695 strain) is organized within a three-gene operon alongside exbD (HP1340) and tonB (HP1341). This arrangement is functionally significant as all three proteins interact to form the energy transduction complex. The exbB gene typically precedes exbD in the operon, with tonB being the downstream gene . This genetic organization allows coordinated expression of these functionally related proteins. The regulatory mechanisms controlling this operon's expression may be linked to acid response and metal homeostasis pathways, though the specific transcriptional regulators remain an active area of investigation. Researchers should note that targeting one gene in this operon experimentally may have polar effects on the expression of downstream genes, requiring careful RT-PCR validation to confirm expression of all operon components when constructing genetic knockouts .

How can recombinant ExbB be effectively expressed and purified for structural studies?

Recombinant ExbB from H. pylori requires careful optimization of expression systems and purification protocols due to its membrane-embedded nature. The most effective approach employs E. coli BL21(DE3) expression systems with pET-based vectors incorporating a C-terminal hexahistidine tag for purification. Expression should be induced with IPTG (0.5 mM) when cultures reach OD600 of approximately 1.0, followed by growth at reduced temperature (30°C) for 3-4 hours to enhance proper folding . Cell disruption is optimally achieved using high-pressure homogenization (~10,000 psi), with membrane fractions isolated through differential centrifugation (125,000 g for 90 minutes). The protein can be extracted using detergents such as n-dodecyl-β-D-maltoside (DDM) at concentrations of 1-2% for solubilization and 0.02-0.05% for purification buffers . Metal affinity chromatography followed by size exclusion chromatography yields the purest preparations. For structural studies, researchers should consider co-expression with ExbD to maintain the native complex configuration, as this appears to enhance stability and functional relevance .

What methodologies are most effective for studying ExbB-ExbD interactions in H. pylori?

Investigating ExbB-ExbD interactions in H. pylori requires a multi-faceted approach combining genetic, biochemical, and biophysical techniques. Co-immunoprecipitation using antibodies against either protein component can confirm their physical association in vivo. For more detailed interaction studies, bacterial two-hybrid systems have successfully demonstrated protein-protein interactions between components of this complex . Structural insights are best obtained through cryo-electron microscopy (cryo-EM), which has revealed the arrangement of ExbB pentamers with ExbD transmembrane helices positioned within the central pore . For functional characterization, researchers should employ proteoliposome reconstitution followed by ion conductance measurements to assess channel formation and cation selectivity. Site-directed mutagenesis targeting conserved residues in the transmembrane domains, particularly in TM1 of ExbB, provides critical information about specificity determinants for interaction with TonB/HasB partners . Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map interaction interfaces with high resolution, complementing the structural data obtained through cryo-EM .

How can researchers accurately assess the stoichiometry of ExbB-ExbD complexes in H. pylori?

Determining the precise stoichiometry of ExbB-ExbD complexes in H. pylori presents significant challenges requiring multiple complementary approaches. Native mass spectrometry offers direct measurement of intact membrane protein complexes and can accurately determine the mass of the entire assembly, though sample preparation requires careful optimization of detergent removal. Analytical ultracentrifugation, particularly sedimentation velocity experiments, provides stoichiometric information based on the hydrodynamic properties of the complex. For visualization-based approaches, single-particle cryo-EM has emerged as the gold standard, revealing ExbB5-ExbD2 stoichiometry in several bacterial species, though H. pylori-specific complexes may differ . Cross-linking coupled with mass spectrometry can verify protein-protein contacts and support stoichiometric assignments. Additionally, fluorescence-based techniques such as single-molecule photobleaching or fluorescence resonance energy transfer (FRET) using tagged proteins can provide insights into subunit counts and arrangement in reconstituted systems or even in live bacterial cells. Researchers should employ at least two independent methods to confidently establish stoichiometry, as membrane protein complexes can adopt different oligomeric states depending on purification and experimental conditions .

What are the critical considerations for successful cryo-EM analysis of H. pylori ExbB-ExbD complexes?

Successful cryo-EM analysis of H. pylori ExbB-ExbD complexes requires meticulous attention to multiple experimental parameters. Sample purity and homogeneity are paramount, necessitating rigorous size exclusion chromatography immediately before grid preparation. The choice of detergent is critical; n-dodecyl-β-D-maltoside (DDM) has proven effective for maintaining complex integrity, though amphipols or nanodiscs may provide more native-like environments that enhance structural resolution . Grid preparation requires optimization of protein concentration (typically 3-5 mg/mL), blotting times, and ice thickness to achieve well-distributed particles without aggregation. For data collection, high-end microscopes (300kV) with direct electron detectors and energy filters are essential for achieving resolution below 4Å. During image processing, researchers should carefully evaluate 2D class averages for evidence of multiple conformational states, as the dynamic nature of these complexes often results in structural heterogeneity. Application of appropriate symmetry (typically C5 for pentameric complexes) during 3D refinement can improve resolution, but should be validated against asymmetric reconstructions to avoid artifacts . For H. pylori-specific complexes, researchers should be prepared to process multiple datasets, as the resolution achievable may be limited by intrinsic flexibility in regions critical for proton translocation and energy transduction.

How can researchers effectively model the transmembrane regions of ExbB?

Modeling transmembrane regions of ExbB presents unique challenges due to the membrane environment and conformational flexibility. Researchers should employ a hybrid approach beginning with homology modeling based on related bacterial ExbB structures, such as those from E. coli (PDB: 5SV0) or S. marcescens . Webservers like Phyre2 provide initial models that should subsequently undergo refinement against experimental data. For cryo-EM-based modeling, the density map should be carefully examined with particular attention to the transmembrane helices, using programs like Coot for manual fitting and adjustments. Molecular dynamics (MD) simulations in explicit lipid bilayers are essential for validating transmembrane models, typically requiring 100-200 ns trajectories to allow proper reorganization of the protein-lipid interface. When building models, researchers should pay special attention to conserved charged residues in transmembrane regions, which often form critical interaction networks for proton conduction or protein-protein interactions. The three transmembrane helices of ExbB should be positioned with proper crossing angles, and lipid molecules observed in the density map should be explicitly modeled using appropriate geometry restraints . Final models must undergo rigorous validation using metrics such as EMRinger scores, Ramachandran statistics, and assessment of model-map correlation specifically in the transmembrane regions to ensure accuracy.

What is currently known about the conformational changes in ExbB during the energy transduction process?

The conformational dynamics of ExbB during energy transduction remain partially characterized, with several key states identified through structural and functional studies. Current evidence suggests that ExbB pentamers undergo subtle but critical rearrangements in response to proton flow, primarily involving the transmembrane helices TM2 and TM3 . These conformational changes are thought to alter the positioning of ExbD transmembrane helices within the central pore, subsequently propagating structural changes to the periplasmic domains of ExbD and ultimately to TonB. Specifically, the cytoplasmic loop connecting TM2 and TM3 in ExbB appears to undergo significant reorientation during the energy transduction cycle, potentially serving as a mechanical lever that converts electrochemical gradient energy into protein conformational energy .

The precise sequence of conformational events remains under investigation, but current models propose at least three distinct states: a resting state, a proton-loaded state, and an energy-transfer state. Hydrogen-deuterium exchange experiments suggest that protonation of key acidic residues in the transmembrane domains triggers these conformational transitions. Importantly, the pentameric arrangement of ExbB creates an asymmetric environment where different subunits may adopt different conformational states simultaneously, potentially creating a rotary mechanism similar to that observed in other biological motors . Future studies employing time-resolved cryo-EM or spectroscopic approaches will be necessary to fully elucidate the conformational trajectory of this complex molecular machine.

How does ExbB contribute to acid resistance in H. pylori?

ExbB plays a crucial role in H. pylori acid resistance through its contribution to periplasmic pH homeostasis and bioenergetics. As part of the ExbB/ExbD/TonB complex, it facilitates energy-dependent uptake of essential metals, particularly nickel, which is required for urease activity—the primary mechanism of acid resistance in H. pylori . Experimental evidence demonstrates that ΔexbD strains (which functionally impair the entire complex) show significantly reduced survival at pH 3.0. While these mutants maintain normal UreI activation and baseline urease activity, they fail to increase total urease activity over time in acidic conditions—a response observed in wildtype strains . This defect can be rescued by supplementation with supra-physiologic nickel concentrations, confirming that ExbB-mediated nickel transport is essential for sustained urease activity under acidic stress.

The ExbB/ExbD/TonB complex also contributes to maintaining membrane potential and periplasmic buffering in the presence of urea, suggesting its role extends beyond metal transport to broader aspects of bioenergetic homeostasis under acid stress . The mechanistic basis likely involves ExbB's function in energizing outer membrane transporters that maintain essential nutrient uptake under the challenging conditions of acid exposure. This makes the ExbB complex a potential non-antibiotic target for H. pylori eradication strategies, as disrupting this system could specifically compromise the pathogen's ability to colonize the acidic gastric environment .

What experimental approaches can effectively measure ExbB-mediated energy transduction?

Measuring ExbB-mediated energy transduction requires sophisticated biophysical techniques that can capture both proton translocation and the resulting energy transfer. Reconstituted proteoliposome systems offer the most controlled environment, wherein purified ExbB-ExbD complexes are incorporated into liposomes with defined lipid composition. Researchers can then establish a pH gradient across the membrane and monitor proton flux using pH-sensitive fluorescent dyes such as BCECF or pyranine . The proton-motive force can be precisely manipulated by varying external pH or adding ionophores like valinomycin to dissipate the electrical component.

For assessing energy transfer to TonB, researchers can employ FRET-based approaches using fluorescently labeled TonB and outer membrane receptors. Changes in FRET efficiency upon energization indicate successful energy transfer through the ExbB-ExbD complex . Alternatively, whole-cell assays measuring uptake of TonB-dependent substrates (such as iron-siderophore complexes or vitamin B12) provide functional readouts of the complete energy transduction system. Genetic approaches using site-directed mutagenesis of conserved residues in ExbB transmembrane helices, particularly acidic residues potentially involved in proton translocation, can identify critical functional determinants .

The quantitative relationship between proton flux and energy transfer can be established using advanced electrophysiological techniques, such as solid-supported membrane electrophysiology, which allows measurement of charge movements associated with proton translocation in a time-resolved manner. These approaches, when combined with structural data, provide a comprehensive picture of the energy transduction mechanism .

How can researchers accurately assess the role of ExbB in nickel transport and urease activity in H. pylori?

Accurately assessing ExbB's role in nickel transport and subsequent urease activity requires a multi-faceted experimental approach combining genetic, biochemical, and physiological methods. Researchers should first construct clean deletion mutants of exbB using allelic replacement techniques, carefully confirming that downstream genes in the operon remain expressed via RT-PCR . These mutants should then be characterized under various conditions to dissect ExbB's specific contributions.

For nickel transport assessment, direct measurement using radioactive 63Ni uptake assays provides the most straightforward quantification. Alternatively, inductively coupled plasma mass spectrometry (ICP-MS) can measure total cellular nickel content in wildtype versus ΔexbB strains under controlled nickel availability conditions. Researchers should conduct these experiments across a pH range (neutral to acidic) to capture condition-dependent effects on transport efficiency .

To connect nickel transport to urease activity, standard colorimetric urease assays should be performed at multiple timepoints after acid exposure, with and without supplementation of high concentrations of nickel. The key experimental design should include the following comparative conditions:

StrainpHNickel ConcentrationMeasurement
Wildtype7.0Normal (0.5 μM)Urease activity, Nickel content
Wildtype3.0Normal (0.5 μM)Urease activity, Nickel content
ΔexbB7.0Normal (0.5 μM)Urease activity, Nickel content
ΔexbB3.0Normal (0.5 μM)Urease activity, Nickel content
ΔexbB3.0High (10 μM)Urease activity, Nickel content

Additionally, researchers should measure membrane potential using fluorescent probes like DiSC3(5) to assess the broader impact on bioenergetics, and determine periplasmic pH using ratiometric GFP variants targeted to the periplasm. These measurements provide mechanistic insights into how ExbB's function in nickel transport ultimately contributes to periplasmic pH homeostasis through the nickel-dependent urease system .

What are the key considerations for designing knockout studies of exbB in H. pylori?

Second, phenotypic analysis must be comprehensive, examining multiple ExbB-dependent processes: acid survival, metal homeostasis (particularly for nickel and iron), membrane potential maintenance, and transport of specific substrates. Researchers should include appropriate positive controls, such as complementation with wildtype exbB on a plasmid or chromosomal integration, to confirm that observed phenotypes result directly from exbB deletion rather than polar or secondary effects .

The growth media composition significantly impacts experimental outcomes, as high metal concentrations can mask transport defects. Defined media with controlled metal concentrations should be used, and experiments should be conducted under both standard laboratory conditions and physiologically relevant acidic conditions (pH 3.0-5.0) that mimic the gastric environment . Additionally, researchers should consider potential redundancy in the H. pylori genome; while not mentioned in the search results, some bacteria possess multiple exbB homologs that could partially compensate for the deletion. Careful homology searches and potentially multiple knockout strains may be necessary to fully elucidate ExbB function in H. pylori .

How can researchers determine if specific mutations in ExbB affect its interaction with ExbD and TonB?

Determining how specific ExbB mutations affect interactions with ExbD and TonB requires a systematic approach combining structural predictions with functional validation. Researchers should first identify candidate interaction sites based on structural data from related bacterial systems, focusing on the transmembrane regions and cytoplasmic domains of ExbB . For transmembrane interactions with ExbD, mutations should target residues facing the central pore of the ExbB pentamer, particularly in TM1, which has been implicated in specificity determination for TonB interactions .

For experimental validation, bacterial two-hybrid or split-protein complementation assays provide in vivo evidence of protein-protein interactions. More quantitative assessment can be achieved through surface plasmon resonance or isothermal titration calorimetry using purified protein components, measuring binding affinities between wildtype or mutant ExbB and its partners . Co-purification experiments, where ExbB variants are expressed with His-tagged ExbD or TonB, can demonstrate whether mutations disrupt complex formation.

Functional consequences should be assessed through complementation assays, introducing mutant exbB variants into knockout strains and measuring restoration of phenotypes such as acid survival, metal transport, or TonB-dependent substrate uptake . Particularly informative are domain-swapping experiments, where regions of ExbB are exchanged with homologous regions from related proteins like TolQ, potentially altering interaction specificity . For high-resolution analysis of interaction interfaces, hydrogen-deuterium exchange mass spectrometry can map changes in solvent accessibility upon complex formation, identifying specific regions involved in protein-protein contacts and how mutations alter these interaction patterns .

What specialized techniques are required for studying ExbB oligomerization in native membranes?

Studying ExbB oligomerization in native membranes presents significant technical challenges requiring specialized approaches that maintain the protein's natural environment. In situ cross-linking with membrane-permeable reagents like formaldehyde or DSP (dithiobis(succinimidyl propionate)) can capture native oligomeric states, with subsequent analysis by SDS-PAGE and immunoblotting to resolve the cross-linked species . More sophisticated approaches include genetic incorporation of photo-activatable unnatural amino acids at potential oligomerization interfaces, allowing highly specific cross-linking upon UV exposure.

For visualization of oligomeric complexes in native membranes, super-resolution microscopy techniques such as PALM (Photoactivated Localization Microscopy) or STORM (Stochastic Optical Reconstruction Microscopy) using fluorescently tagged ExbB can reveal spatial clustering and approximate complex sizes. Complementary to this, FRET microscopy with differentially labeled ExbB molecules can provide evidence of close association consistent with oligomerization .

Biochemical approaches that preserve native membrane context include styrene-maleic acid lipid particle (SMALP) extraction, which isolates membrane protein complexes with their surrounding lipid environment intact. These preparations can then be analyzed by analytical ultracentrifugation or native mass spectrometry to determine oligomeric states. Blue native PAGE of carefully solubilized membrane fractions provides another approach for resolving intact complexes .

To connect oligomeric state with function, researchers can employ cysteine cross-linking approaches where strategically placed cysteine pairs should form disulfide bonds only in specific oligomeric arrangements. By measuring functional parameters (like proton conductance or substrate transport) under cross-linking conditions, the relationship between oligomerization and activity can be established. These techniques collectively provide a comprehensive assessment of ExbB oligomerization while maintaining the critical native membrane context .

What are the most promising strategies for targeting ExbB as a non-antibiotic approach for H. pylori eradication?

The ExbB/ExbD/TonB complex represents a promising non-antibiotic target for H. pylori eradication due to its essential role in acid adaptation and nutrient acquisition. Several targeting strategies show particular promise based on current understanding of this system. Small molecule inhibitors designed to disrupt ExbB pentamer formation or interfere with ExbB-ExbD interactions could effectively disable the energy transduction system. Structure-based drug design focusing on the conserved residues in the transmembrane domains, particularly those involved in proton translocation or protein-protein interactions, offers the most direct approach . Compounds that bind to the cytoplasmic domain of ExbB and allosterically alter its conformation could also disrupt function without needing to penetrate the membrane.

Peptide-based inhibitors mimicking critical interaction regions of ExbD or TonB represent another promising approach. These could competitively inhibit complex formation while offering high specificity. For delivery of these various inhibitors to the bacterial inner membrane, liposomal formulations or conjugation to outer membrane-targeting molecules could enhance efficacy .

Alternatively, vaccination strategies using recombinant ExbB as an antigen may generate antibodies that, while not directly accessing the protein in intact bacteria, could target ExbB during periods of membrane perturbation or in conjunction with other treatments. The essential nature of this complex for H. pylori survival in the acidic gastric environment, coupled with its structural differences from human proteins, makes it an attractive target for development of highly specific therapeutic agents with potentially minimal effects on the broader microbiome .

What are the current knowledge gaps in understanding ExbB function in H. pylori compared to other bacterial species?

Despite significant advances in understanding bacterial bioenergetic systems, several critical knowledge gaps remain regarding ExbB function specifically in H. pylori compared to better-studied organisms like E. coli. First, the high-resolution structure of H. pylori ExbB, either alone or in complex with ExbD and TonB, has not been determined, leaving uncertainty about species-specific structural adaptations that might reflect its unique ecological niche . The stoichiometry of the complex in H. pylori also remains unconfirmed, with both pentameric and hexameric arrangements observed in other bacteria .

The precise mechanism by which H. pylori ExbB contributes to acid resistance beyond facilitating nickel uptake for urease activity requires further investigation. Potential direct roles in regulating periplasmic pH through proton translocation or interactions with other acid response systems have not been fully explored . Additionally, the repertoire of TonB-dependent receptors and transported substrates in H. pylori differs from other bacteria, raising questions about whether ExbB has evolved specialized features to support these specific transport needs.

The regulatory mechanisms controlling exbB expression in H. pylori, particularly in response to acid exposure and metal availability, remain poorly characterized compared to other bacterial species. Understanding these regulatory networks could reveal additional targeting opportunities . Finally, while genetic studies have demonstrated the importance of ExbB for H. pylori colonization and persistence, detailed mechanistic understanding of how ExbB function impacts virulence factor delivery, biofilm formation, and host-pathogen interactions during infection remains limited. Addressing these knowledge gaps would significantly advance both fundamental understanding of this unique pathogen and development of targeted therapeutic approaches .

How might emerging structural biology techniques further elucidate the ExbB-ExbD-TonB energy transduction mechanism?

Emerging structural biology techniques hold tremendous promise for resolving the remaining questions surrounding the ExbB-ExbD-TonB energy transduction mechanism. Time-resolved cryo-electron microscopy (TR-cryo-EM) represents perhaps the most transformative approach, capable of capturing the complex in multiple conformational states during the energy transduction cycle. By using microfluidic devices to rapidly mix protons with the complex before flash-freezing, researchers could potentially visualize the sequential structural changes that occur during energy transfer . This technique, combined with focused ion beam milling for imaging proteins in their native membrane environment (cryo-FIB), could provide unprecedented insights into how the complex functions within the actual bacterial envelope.

Single-particle cryo-electron tomography (cryo-ET) offers another powerful approach, particularly for visualizing the complete ExbB-ExbD-TonB complex spanning the periplasmic space to connect with outer membrane receptors. This technique could reveal how energy is transmitted across the cell envelope in the native context . For dynamic information on a faster timescale, integrative approaches combining structural data with molecular dynamics simulations using specialized force fields for membrane proteins would elucidate transition pathways between observed states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.